SitesBLAST
Comparing Dsui_0130 FitnessBrowser__PS:Dsui_0130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
62% identity, 100% coverage: 1:757/758 of query aligns to 1:757/759 of P76558
- K56 (≠ E57) modified: N6-acetyllysine
6zngF Maeb full-length acetyl-coa bound state (see paper)
47% identity, 99% coverage: 8:754/758 of query aligns to 6:743/753 of 6zngF
- active site: Y38 (= Y40), A74 (= A76), K93 (= K95), E135 (= E137), D136 (= D138), D160 (= D162), D161 (= D163), N286 (= N288)
- binding acetyl coenzyme *a: R511 (≠ M518), K514 (≠ R521), Y552 (≠ H560), A553 (≠ Q561), R557 (≠ F565), L560 (≠ K568), P571 (≠ Y580), T590 (≠ Y599), V591 (= V600), N592 (= N601), L593 (≠ Y602), Y625 (≠ H634), Q659 (≠ H669), L690 (= L700), N694 (= N704), Q724 (≠ T735)
6zn7A Maeb malic enzyme domain apoprotein (see paper)
58% identity, 53% coverage: 5:408/758 of query aligns to 2:405/405 of 6zn7A
- active site: Y37 (= Y40), A73 (= A76), K92 (= K95), E134 (= E137), D135 (= D138), D159 (= D162), D160 (= D163), N285 (= N288)
- binding magnesium ion: E134 (= E137), D135 (= D138), D160 (= D163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T164 (= T167), N191 (≠ S194), A193 (= A196), G194 (= G197), A195 (= A198), S196 (≠ A199), D218 (= D221), S219 (≠ I222), K235 (= K238), L260 (= L263), S261 (= S264), V262 (≠ A265), M283 (≠ L286), N285 (= N288), V315 (= V318)
6zn4A Maeb malic enzyme domain apoprotein (see paper)
58% identity, 53% coverage: 5:408/758 of query aligns to 2:405/406 of 6zn4A
5ceeA Malic enzyme from candidatus phytoplasma aywb in complex with NAD and mg2+ (see paper)
45% identity, 49% coverage: 32:405/758 of query aligns to 26:385/387 of 5ceeA
- active site: Y34 (= Y40), A70 (= A76), K89 (= K95), E131 (= E137), D132 (= D138), D156 (= D162), D157 (= D163), N283 (= N288)
- binding magnesium ion: E131 (= E137), D132 (= D138), D157 (= D163)
- binding nicotinamide-adenine-dinucleotide: T161 (= T167), N188 (≠ S194), G189 (= G195), G191 (= G197), A193 (= A199), D213 (= D221), K214 (≠ I222), V258 (≠ L263), S259 (= S264), I263 (≠ V268), L281 (= L286), N283 (= N288), V312 (= V318), N314 (= N320)
2dvmA NAD complex structure of ph1275 protein from pyrococcus horikoshii
44% identity, 54% coverage: 6:413/758 of query aligns to 1:405/438 of 2dvmA
- active site: Y37 (= Y40), R73 (≠ A76), K92 (= K95), E134 (= E137), D135 (= D138), D159 (= D162), D160 (= D163), N296 (= N288)
- binding nicotinamide-adenine-dinucleotide: T164 (= T167), G194 (= G197), A195 (= A198), A196 (= A199), V217 (≠ T220), E218 (≠ D221), L219 (≠ I222), P224 (vs. gap), F269 (≠ L263), T270 (≠ S264), L294 (= L286), N296 (= N288), N327 (= N320)
2a9fA Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
49% identity, 44% coverage: 20:354/758 of query aligns to 18:350/383 of 2a9fA
2haeD Crystal structure of a putative malic enzyme (malate oxidoreductase)
45% identity, 48% coverage: 10:371/758 of query aligns to 2:361/373 of 2haeD
2haeB Crystal structure of a putative malic enzyme (malate oxidoreductase)
45% identity, 48% coverage: 10:371/758 of query aligns to 2:361/373 of 2haeB
- active site: Y31 (= Y40), A67 (= A76), K86 (= K95), E128 (= E137), D129 (= D138), D153 (= D162), D154 (= D163), N280 (= N288)
- binding nicotinamide-adenine-dinucleotide: T158 (= T167), N185 (≠ S194), G188 (= G197), A189 (= A198), A190 (= A199), D210 (= D221), R211 (≠ I222), V255 (≠ L263), S256 (= S264), R257 (≠ A265), L278 (= L286), A279 (= A287), N280 (= N288), N311 (= N320)
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 45% coverage: 416:758/758 of query aligns to 372:713/714 of Q8ZND6
Sites not aligning to the query:
- 252 R→H: Increases speed of forward and back reactions by 2-3 fold. Not inhibited by NADH.
- 273 G→D: Increases speed of forward and back reactions by 2-3 fold.
- 294 M→I: Slightly decreases speed of forward and back reactions.
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
31% identity, 42% coverage: 430:750/758 of query aligns to 7:330/339 of 6ioxA
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
29% identity, 42% coverage: 437:754/758 of query aligns to 11:324/325 of 1xcoD
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
26% identity, 43% coverage: 431:757/758 of query aligns to 5:331/333 of P38503
- C159 (vs. gap) mutation to A: Loss of activity.; mutation to S: No loss of activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
26% identity, 43% coverage: 431:757/758 of query aligns to 4:330/332 of 2af3C
- binding coenzyme a: R86 (≠ M518), S127 (≠ H560), L131 (≠ R564), V135 (≠ K568), L146 (≠ S579), A147 (≠ Y580), G172 (≠ Y599), M173 (≠ V600), M173 (≠ V600), V174 (≠ N601), E175 (≠ Y602), N278 (= N704), Y281 (≠ F707), K282 (≠ N708), Q285 (≠ K711), G294 (= G721), P295 (= P722), T297 (≠ L724), D306 (≠ I733), L307 (= L734), S308 (≠ T735)
1gq2A Malic enzyme from pigeon liver (see paper)
28% identity, 37% coverage: 70:353/758 of query aligns to 137:475/555 of 1gq2A
- active site: R143 (≠ A76), K161 (vs. gap), E233 (= E137), D234 (= D138), D256 (= D162), D257 (= D163), N396 (= N288)
- binding manganese (ii) ion: K161 (vs. gap), E233 (= E137), D234 (= D138), D257 (= D163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R143 (≠ A76), G146 (= G79), N237 (≠ A141), T261 (= T167), G289 (= G195), A290 (= A196), G291 (= G197), E292 (≠ A198), A293 (= A199), V322 (≠ T220), D323 (= D221), S324 (≠ I222), A368 (≠ S264), I370 (vs. gap), L394 (= L286), N396 (= N288), G440 (≠ V318), N441 (= N319), N442 (= N320)
- binding oxalate ion: R143 (≠ A76), L145 (= L78), D257 (= D163), N396 (= N288), N442 (= N320)
Sites not aligning to the query:
P40927 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Columba livia (Rock dove) (see 3 papers)
28% identity, 37% coverage: 70:353/758 of query aligns to 138:476/557 of P40927
- D141 (≠ N73) mutation to N: Increases Km for manganese 14-fold. Increases Km for malate 5-fold.
- R144 (≠ A76) binding ; binding
- K162 (vs. gap) binding ; mutation to A: Decreases kcat 235-fold. no effect on Km for NADP.
- D194 (≠ K101) mutation to N: No effect on Km for manganese. Increases Km for malate 8-fold.
- E234 (= E137) binding
- D235 (= D138) binding
- N238 (≠ A141) binding
- D258 (= D163) binding
- AGEA 291:294 (≠ AGAA 196:199) binding
- S325 (≠ I222) binding
- K340 (≠ I237) mutation to A: Increases Km for NADP 65-fold. No effect on kcat.
- N397 (= N288) binding
- N443 (= N320) binding ; binding
- D464 (≠ E341) mutation to N: No effect.
P16243 NADP-dependent malic enzyme, chloroplastic; NADP-ME; EC 1.1.1.40 from Zea mays (Maize) (see 3 papers)
26% identity, 51% coverage: 36:419/758 of query aligns to 180:625/636 of P16243
- R237 (≠ A76) mutation to L: Decreases kcat 530-fold. Increases Km for NADP 36-fold and Km for malate 10-fold.
- K255 (= K95) mutation to I: Increases Km for malate 10-fold, and Km for NADP 15-fold. Decreases kcat 200-fold.
- E339 (= E148) mutation to A: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
- A387 (= A199) mutation to G: Decreases kcat 48-fold. Increases Km for NADP 4-fold. Increases Km for malate 6-fold.
- A392 (≠ L204) mutation to G: No effect on kcat. Increases Km for NADP 3.5-fold. Increases Km for malate 2.5-fold.
- KK 435:436 (≠ KA 238:239) mutation to LL: No effect on kcat and on Km for malate. Increases Km for NADP 9-fold.
- Q503 (≠ D296) mutation to E: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
- L544 (≠ I327) mutation to F: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
Sites not aligning to the query:
- 140 F→I: Decreases kcat 8-fold. Decreases Km for NADP 2-fold, increases Km for malate 2-fold.
7x11A Crystal structure of me1 in complex with NADPH (see paper)
24% identity, 42% coverage: 36:353/758 of query aligns to 93:482/564 of 7x11A
- binding 6-[(7-methyl-2-propyl-imidazo[4,5-b]pyridin-4-yl)methyl]-2-[2-(1H-1,2,3,4-tetrazol-5-yl)phenyl]-1,3-benzothiazole: N244 (≠ A141), F248 (= F145), I265 (≠ Q164), Q266 (≠ H165), L302 (= L201), G303 (≠ A202), H306 (≠ D205), E345 (= E236), D470 (≠ E341)
- binding manganese (ii) ion: E240 (= E137), D241 (= D138), D264 (= D163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R150 (≠ A76), N244 (≠ A141), T268 (= T167), A297 (= A196), G298 (= G197), E299 (≠ A198), A300 (= A199), D330 (= D221), S331 (≠ I222), K332 (= K223), K346 (≠ I237), V374 (≠ L263), A375 (≠ S264), A376 (= A265), I377 (vs. gap), L401 (= L286), S402 (≠ A287), N403 (= N288), G447 (≠ V318)
8eyoA Crystal structure of human mitochondrial NADP+ malic enzyme 3 with NADP bound (see paper)
27% identity, 37% coverage: 70:353/758 of query aligns to 136:474/562 of 8eyoA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T260 (= T167), Q287 (≠ S194), A289 (= A196), G290 (= G197), E291 (≠ A198), A292 (= A199), D322 (= D221), S323 (≠ I222), K338 (≠ I237), V366 (≠ L263), A367 (≠ S264), I369 (vs. gap), L393 (= L286), S394 (≠ A287), N395 (= N288), G439 (≠ V318), N441 (= N320)
6w49A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec010) (see paper)
27% identity, 37% coverage: 68:351/758 of query aligns to 131:475/543 of 6w49A
Sites not aligning to the query:
Query Sequence
>Dsui_0130 FitnessBrowser__PS:Dsui_0130
MDNKQLREAALYYHRHPKPGKISVQPTKQLTNQYDLSMAYSPGVAAACEEIVANPAEVST
VTARANLVGVITNGTAVLGLGNIGPLAAKPVMEGKGVLFKKFANIDVFDLEIEQRDPDML
IETIASLEPTFGGINLEDIKAPECFYIEKKLRERMKIPVFHDDQHGTAIVVGAAILNGLT
YLGKDLKQIKLVTSGAGAAALACLDLLVMLGVPVENIWVTDIKGVVYEGRVEEMDEIKAR
YAKKTDARTLGEVIEGADVFLGLSAGGVLKQDMVAKMAKNPLILALANPTPEILPDLVKE
VRDDAIIATGRSDYPNQVNNVLCFPFIFRGALDVGATTITEEMKLAAVKAIAELARAEQS
EIVAAAYGEKVSGFGPEYLIPKPFDPRLIVKIAPAVARAAMDSGVATRPITDWPAYLQSL
NEFVYHSGLIMKPVFAQAKAAPKRIIYAEGEDERVLRAVQVVVEERIARPILIGRPAVIN
AKVEAAGLRIRESLDFDILDPDNNPRYDEFWQEYHRLMERRGVSLDYAKREVRRRHTLCG
SLAVRLGMADGLICGTFGRHQLHRFYVKHVIGTNDRSSSYYTLNLLMLPGRTVFIGDTYV
NYDPSAEQLAEMTLLAADEIRRFGITPKVALLSHSTFGTEDTPTSLKMRKVLELLAEQAP
ELEAEGEMHGDAALDEQIRLQGFPNSRLKGQANLLVMPTLDAANISFNLLKTAAGDNLTV
GPILIGTARPVHILTPTATVRRIVNMTALTVVDAGTER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory