Comparing Dsui_0166 FitnessBrowser__PS:Dsui_0166 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
47% identity, 95% coverage: 14:372/377 of query aligns to 5:363/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
47% identity, 95% coverage: 14:372/377 of query aligns to 7:365/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
42% identity, 95% coverage: 14:372/377 of query aligns to 5:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
41% identity, 95% coverage: 14:372/377 of query aligns to 5:321/323 of 2j5vA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
34% identity, 68% coverage: 6:262/377 of query aligns to 7:256/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
33% identity, 68% coverage: 6:262/377 of query aligns to 7:234/236 of 7f5xA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
33% identity, 62% coverage: 13:247/377 of query aligns to 2:223/241 of 2akoA
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
34% identity, 28% coverage: 156:262/377 of query aligns to 120:223/225 of Q8U122
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
34% identity, 28% coverage: 156:262/377 of query aligns to 121:224/226 of 2bmuB
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
32% identity, 28% coverage: 156:262/377 of query aligns to 122:217/219 of 2ji5A
Sites not aligning to the query:
3wwmA Crystal structure of lysz from thermus thermophilus with adp (see paper)
31% identity, 35% coverage: 125:256/377 of query aligns to 140:264/269 of 3wwmA
Sites not aligning to the query:
O50147 [LysW]-aminoadipate kinase; EC 2.7.2.17 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
31% identity, 35% coverage: 125:256/377 of query aligns to 140:264/269 of O50147
Sites not aligning to the query:
3ll5A Crystal structure of t. Acidophilum isopentenyl phosphate kinase product complex (see paper)
31% identity, 18% coverage: 128:195/377 of query aligns to 115:183/233 of 3ll5A
Sites not aligning to the query:
>Dsui_0166 FitnessBrowser__PS:Dsui_0166
MSPTTSRTANAGRLVVKVGSALVTNNGAGLDLAAIHEWARQIAELRHNGKQVVLVSSGAI
ACGMQRLGWQKRPKAVHELQAAAAVGQMGLAQVYESAFSAHGLHTAQILLTHDDLADRKR
YLNARATLTTLLELGVVPIINENDTVVTDEIKFGDNDTLGALVANLVEADCLIILTDQPG
LFTADPRKDPSATLITSARAGDPSLEAMAGGAGTQIGTGGMITKVLAAKRAARSGADTVI
ASGREKSPLTRLATGESVGTLLVADTLPMTARKQWLADHLQLAGKLTLDQGAIQALRQGK
SLLPVGVREVHGDFERGAAVACLDESGREIARGLCNYGSSEVRLIAKHSSSDIEDILGYM
EEPELIHRDNMVCLHEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory