Comparing Dsui_0318 Dsui_0318 3-hydroxyacyl-CoA dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 36% coverage: 9:295/795 of query aligns to 5:284/286 of P9WNP7
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
30% identity, 37% coverage: 6:296/795 of query aligns to 1:289/291 of 1f0yA
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
30% identity, 37% coverage: 6:296/795 of query aligns to 1:289/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
30% identity, 37% coverage: 6:296/795 of query aligns to 1:289/293 of 1f12A
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
30% identity, 37% coverage: 6:296/795 of query aligns to 24:312/314 of P00348
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
30% identity, 37% coverage: 6:296/795 of query aligns to 24:312/314 of Q16836
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
29% identity, 47% coverage: 10:381/795 of query aligns to 314:690/719 of 6tnmA
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 47% coverage: 10:381/795 of query aligns to 314:690/729 of P21177
Sites not aligning to the query:
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
30% identity, 36% coverage: 9:295/795 of query aligns to 1:278/280 of 4kuhA
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
30% identity, 36% coverage: 9:295/795 of query aligns to 1:278/282 of 4kugA
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
32% identity, 36% coverage: 9:295/795 of query aligns to 2:279/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
32% identity, 36% coverage: 9:295/795 of query aligns to 2:279/283 of 4pzdA
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
30% identity, 37% coverage: 9:306/795 of query aligns to 314:605/715 of 1wdlA
Sites not aligning to the query:
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
30% identity, 37% coverage: 9:306/795 of query aligns to 314:605/715 of P28793
Sites not aligning to the query:
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
30% identity, 36% coverage: 9:295/795 of query aligns to 314:590/707 of 1wdmA
Sites not aligning to the query:
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
29% identity, 36% coverage: 10:295/795 of query aligns to 1:277/281 of 6aa8E
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
34% identity, 25% coverage: 6:205/795 of query aligns to 329:525/726 of 8oqvA
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
34% identity, 25% coverage: 6:205/795 of query aligns to 325:521/723 of 8oqqA
Sites not aligning to the query:
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
34% identity, 25% coverage: 6:205/795 of query aligns to 325:521/723 of 8oqpA
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
34% identity, 25% coverage: 6:205/795 of query aligns to 333:529/731 of 4b3iA
Sites not aligning to the query:
>Dsui_0318 Dsui_0318 3-hydroxyacyl-CoA dehydrogenase
MSENSKLIVRRAAVLGAGVMGAQIAAHLANADVPVVLFDLAAKEGDPNGIVKKALDGLKK
LDPAPLASKERLAHIDAANYEQHLALLGECDLVIEAIAEKMEWKEDLYRKIAPHLKAGAI
VASNTSGLSINKLSSTVPAEKRANFCGIHFFNPPRYMPLVEIIATTDSDPAMLDRLETWL
VSRLGKSVVRAKDTPNFVANRVGVFSILAVMHHTQRLEMGFDEVDALTGPKIGRPKSATY
RTADVVGLDTLAHVVKTMQDTLPGDPWHSHFQAPAWLAALIEKGALGQKTKCGIFRKQGK
EIQVLDLAKQDYRTSAGEIAPEVAEILKIKNPAEKFAALRASSHKQAQFLWAIYRDVFHY
CAFHLESIADNARDVDFAMRWGFGWAMGPFETWQAAGWKAIAAAVQADIDAGLAMSTAPL
PAWVMARDGVHEPAGSWSAAEQGLKPRSALPVYGRQLYPETVLGEAPAAKGETVWENAGV
RLWTHAQDPKIAILSITSKMHAIGDEVLDGVLEAVSRAERDFDGLVIWHEAPFAVGANLQ
QVGEACAKGEFDKLEATVAKFQRASMAFKHAQVPTVAAVQGMALGGGCEFVMHAAHRVMA
LESYVGLVEAGVGLIPAGGGCKEFAIRAAQFGARQAGGELFPFLQNVFQTIAMAKVAKSA
LEVQEMGFGKEADDIVFNAQELLFVAIARARAMAAAGYRPPLRARNIPVAGRPGIATLEM
MLVNMKEGGFISAHDYRVARSAAIALCGGDVEQGSRVDDEWLLTVERREFVELLKTPETQ
ARIKHMLETGKPLRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory