SitesBLAST
Comparing Dsui_0400 FitnessBrowser__PS:Dsui_0400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
46% identity, 56% coverage: 270:618/620 of query aligns to 2:337/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G299), G34 (= G302), T35 (≠ S303), I36 (= I304), D56 (≠ E324), H57 (≠ V325), S82 (≠ D352), I83 (≠ V353), A104 (= A374), A105 (= A375), A106 (= A376), K108 (= K378), N123 (= N394), I146 (= I417), K162 (= K433), F184 (= F457), G185 (= G458), N186 (= N459), V187 (= V460), S190 (= S463), S191 (≠ N464)
- binding uridine-5'-diphosphate: K150 (= K421), N186 (= N459), S193 (= S466), V194 (= V467), T209 (= T482), L210 (≠ V483), T211 (= T484), I215 (= I488), R217 (= R490), E279 (= E554)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
45% identity, 56% coverage: 270:618/620 of query aligns to 2:337/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G299), G34 (= G302), T35 (≠ S303), I36 (= I304), D56 (≠ E324), H57 (≠ V325), S82 (≠ D352), I83 (≠ V353), A104 (= A374), A105 (= A375), A106 (= A376), K108 (= K378), N123 (= N394), I146 (= I417), K162 (= K433), F184 (= F457), G185 (= G458), N186 (= N459), V187 (= V460), S190 (= S463), S191 (≠ N464)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K378), H109 (= H379), T148 (= T419), G185 (= G458), N186 (= N459), S193 (= S466), V194 (= V467), T209 (= T482), L210 (≠ V483), T211 (= T484), I215 (= I488), R217 (= R490), R276 (= R551), E279 (= E554)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
38% identity, 45% coverage: 289:565/620 of query aligns to 2:276/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G299), T14 (≠ G301), G15 (= G302), T16 (≠ S303), I17 (= I304), S37 (≠ E324), R38 (≠ V325), S39 (= S326), D63 (= D352), I64 (≠ V353), V83 (≠ A374), A84 (= A375), K87 (= K378), T125 (≠ I417), S127 (≠ T419), Y137 (≠ M429), K141 (= K433), F167 (= F457), V170 (= V460), S173 (= S463), R174 (≠ N464)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K378), H88 (= H379), S127 (≠ T419), N128 (≠ D420), Y137 (≠ M429), N169 (= N459), S176 (= S466), V177 (= V467), L180 (≠ T470), T192 (= T482), T194 (= T484), M198 (≠ I488), R200 (= R490), L234 (≠ I525), E265 (= E554)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
36% identity, 45% coverage: 289:566/620 of query aligns to 1:270/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G299), T13 (≠ G301), G14 (= G302), S15 (= S303), F16 (≠ I304), S36 (≠ E324), R37 (≠ V325), D38 (≠ S326), K41 (≠ I333), D60 (= D352), V61 (= V353), A80 (= A374), A81 (= A375), A82 (= A376), K84 (= K378), T99 (≠ N394), L122 (≠ I417), K138 (= K433), Y164 (≠ F457)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
32% identity, 45% coverage: 288:568/620 of query aligns to 2:271/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K378), S176 (= S466), V177 (= V467), T195 (= T484), M199 (≠ I488), R201 (= R490), M235 (≠ I525), R254 (= R551), E257 (= E554)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G299), T15 (≠ G301), G16 (= G302), S17 (= S303), F18 (≠ I304), S39 (≠ E324), R40 (≠ V325), D41 (≠ S326), K44 (≠ A329), D63 (= D352), V64 (= V353), A83 (= A374), A84 (= A375), A85 (= A376), K87 (= K378), L125 (≠ I417), S126 (= S418), Y137 (≠ M429), K141 (= K433), Y167 (≠ F457), G168 (= G458), V170 (= V460)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
32% identity, 45% coverage: 288:568/620 of query aligns to 2:271/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G299), T15 (≠ G301), G16 (= G302), S17 (= S303), F18 (≠ I304), R40 (≠ V325), D41 (≠ S326), K44 (≠ A329), D63 (= D352), V64 (= V353), A83 (= A374), A84 (= A375), A85 (= A376), K87 (= K378), L125 (≠ I417), S126 (= S418), K141 (= K433), Y167 (≠ F457), G168 (= G458), V170 (= V460), R174 (≠ N464)
- binding uridine-5'-diphosphate-glucose: K87 (= K378), T127 (= T419), K129 (= K421), Y137 (≠ M429), N169 (= N459), S176 (= S466), V177 (= V467), P193 (≠ T482), T195 (= T484), M199 (≠ I488), R201 (= R490), M235 (≠ I525), R254 (= R551), E257 (= E554)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
32% identity, 45% coverage: 288:568/620 of query aligns to 2:271/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G299), T15 (≠ G301), G16 (= G302), S17 (= S303), F18 (≠ I304), R40 (≠ V325), D41 (≠ S326), K44 (≠ A329), D63 (= D352), V64 (= V353), A84 (= A375), A85 (= A376), K87 (= K378), S126 (= S418), Y137 (≠ M429), K141 (= K433), Y167 (≠ F457), G168 (= G458), V170 (= V460), S173 (= S463), R174 (≠ N464)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K378), D128 (= D420), K129 (= K421), N169 (= N459), G175 (= G465), S176 (= S466), V177 (= V467), P193 (≠ T482), I194 (≠ V483), M199 (≠ I488), R201 (= R490), M235 (≠ I525), R254 (= R551), E257 (= E554)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
32% identity, 45% coverage: 288:568/620 of query aligns to 2:271/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G299), T15 (≠ G301), G16 (= G302), S17 (= S303), F18 (≠ I304), S39 (≠ E324), R40 (≠ V325), D41 (≠ S326), K44 (≠ A329), D63 (= D352), V64 (= V353), A83 (= A374), A84 (= A375), A85 (= A376), K87 (= K378), T102 (≠ N394), L125 (≠ I417), S126 (= S418), T127 (= T419), Y137 (≠ M429), K141 (= K433), Y167 (≠ F457), G168 (= G458), V170 (= V460), S173 (= S463), R174 (≠ N464)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K378), T127 (= T419), D128 (= D420), K129 (= K421), Y137 (≠ M429), N169 (= N459), S176 (= S466), V177 (= V467), P193 (≠ T482), T195 (= T484), M199 (≠ I488), R201 (= R490), M235 (≠ I525), R254 (= R551), E257 (= E554)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
32% identity, 45% coverage: 289:568/620 of query aligns to 1:269/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G299), T13 (≠ G301), G14 (= G302), S15 (= S303), F16 (≠ I304), S37 (≠ E324), R38 (≠ V325), D39 (≠ S326), K42 (≠ A329), D61 (= D352), V62 (= V353), A81 (= A374), A82 (= A375), A83 (= A376), K85 (= K378), T100 (≠ N394), L123 (≠ I417), S124 (= S418), K139 (= K433), Y165 (≠ F457), G166 (= G458), V168 (= V460), S171 (= S463), R172 (≠ N464)
- binding uridine-5'-diphosphate: K127 (= K421), N167 (= N459), V175 (= V467), P191 (≠ T482), I192 (≠ V483), T193 (= T484), M197 (≠ I488), R199 (= R490), M233 (≠ I525), R252 (= R551)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
32% identity, 45% coverage: 288:568/620 of query aligns to 6:275/333 of O25511
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
35% identity, 44% coverage: 292:565/620 of query aligns to 13:277/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K378), Q94 (≠ H379), N175 (= N459), S179 (= S463), R180 (≠ N464), S182 (= S466), V183 (= V467), L186 (≠ T470), T198 (= T482), I199 (≠ V483), T200 (= T484), M204 (≠ I488), R206 (= R490), V240 (= V526), R263 (= R551), E266 (= E554)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
35% identity, 44% coverage: 292:565/620 of query aligns to 13:277/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G299), T22 (≠ G301), G23 (= G302), S24 (= S303), F25 (≠ I304), S45 (≠ E324), R46 (≠ V325), D47 (≠ S326), K50 (≠ I333), D69 (= D352), V70 (= V353), A89 (= A374), A90 (= A375), A91 (= A376), K93 (= K378), L131 (≠ I417), T133 (= T419), K147 (= K433), Y173 (≠ F457)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H379), V95 (= V380), K135 (= K421), N175 (= N459), S182 (= S466), V183 (= V467), L186 (≠ T470), T198 (= T482), T200 (= T484), M204 (≠ I488), V240 (= V526), R263 (= R551), E266 (= E554)
Sites not aligning to the query:
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: 278, 313, 314, 315, 316, 320
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
35% identity, 44% coverage: 292:565/620 of query aligns to 5:269/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G299), T14 (≠ G301), G15 (= G302), F17 (≠ I304), S37 (≠ E324), R38 (≠ V325), D39 (≠ S326), K42 (≠ I333), D61 (= D352), V62 (= V353), R63 (≠ K354), A81 (= A374), A82 (= A375), A83 (= A376), K85 (= K378), S124 (= S418), T125 (= T419), K139 (= K433), Y165 (≠ F457), G166 (= G458)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
25% identity, 45% coverage: 290:571/620 of query aligns to 3:256/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G299), S14 (≠ G301), G15 (= G302), S16 (= S303), L17 (≠ I304), R36 (≠ V325), D37 (≠ S326), D59 (= D352), I60 (≠ V353), A81 (= A374), A82 (= A375), A83 (= A376), K85 (= K378), V128 (≠ I417), Y140 (≠ M429), K144 (= K433), Y168 (≠ F457), G169 (= G458), V171 (= V460)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 41% coverage: 274:529/620 of query aligns to 12:266/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G302), S41 (= S303), I42 (= I304), D62 (≠ E324), I63 (≠ V325), D92 (≠ V349), I93 (≠ V350), L114 (≠ A374), S115 (≠ A375), A116 (= A376), K118 (= K378), V158 (≠ I417), D161 (= D420), K174 (= K433), V198 (= V460), S201 (= S463)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
29% identity, 40% coverage: 292:542/620 of query aligns to 3:223/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G299), T12 (≠ G301), G13 (= G302), S14 (= S303), F15 (≠ I304), S35 (≠ E324), R36 (≠ V325), D37 (≠ S326), K40 (≠ I333), D59 (= D352), V60 (= V353), A80 (= A375), A81 (= A376), K83 (= K378), L121 (≠ I417), T123 (= T419), K137 (= K433), Y163 (≠ F457), G164 (= G458)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 39% coverage: 274:515/620 of query aligns to 10:236/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G302), S39 (= S303), I40 (= I304), D60 (≠ E324), I61 (≠ V325), L89 (≠ C348), D90 (≠ V349), I91 (≠ V350), L112 (≠ A374), S113 (≠ A375), A114 (= A376), K116 (= K378), D159 (= D420), K172 (= K433), N195 (= N459), V196 (= V460), S199 (= S463)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 42% coverage: 293:552/620 of query aligns to 9:286/667 of Q9LPG6
- G18 (= G302) mutation to A: Abolishes dehydratase activity.
- K36 (≠ Q319) mutation to A: Reduces dehydratase activity.
- D96 (≠ P381) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K433) mutation to A: Abolishes dehydratase activity.
- G193 (= G462) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
25% identity, 42% coverage: 293:552/620 of query aligns to 7:284/669 of Q9SYM5
- R283 (= R551) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
2pzmA Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with NAD and udp (see paper)
28% identity, 34% coverage: 295:506/620 of query aligns to 10:222/316 of 2pzmA
- active site: T123 (vs. gap), Y147 (≠ M429), K151 (= K433), P176 (≠ S463)
- binding nicotinamide-adenine-dinucleotide: G14 (= G299), G17 (= G302), C18 (≠ S303), L19 (≠ I304), D38 (≠ S326), N39 (≠ E327), F40 (= F328), T42 (≠ L330), G43 (≠ Y331), S60 (≠ D352), V61 (= V353), S82 (vs. gap), A83 (= A374), A84 (= A375), Y86 (= Y377), T98 (≠ N394), F121 (vs. gap), Q122 (vs. gap), T123 (vs. gap), Y147 (≠ M429), K151 (= K433), V173 (= V460)
- binding uridine-5'-diphosphate: F197 (≠ T482), C198 (≠ V483), S199 (≠ T484), R203 (= R490)
Sites not aligning to the query:
Query Sequence
>Dsui_0400 FitnessBrowser__PS:Dsui_0400
MPDSHQGDSAQKAFLGLISRRFIASAYDLVALIVCWLAAYWLRFNLSLPDEYLRAGLFSL
AILVPVYVPLFWLSGLYRGIWRYASLMDLRRIIVSVGLGGLVTAVAVFMTGMPGVPRSVL
VLHPILLILAMGGGRFLYRAWKDRCLYGHLALSGESVLILGAGEVGERLIRELQRSPQWR
VAGLLDNDPAKHGREVHGVKIRGDIASMVHWAKELEVGHVIVAMPSVSAAVRRGAMEQAV
QAGLKVLTVPALDDLLSGRVSLSQIRQVELEDILGREPVQLDDAGLSRLIAERTILVTGA
GGSIGSELARQIARFAPRQLVLFEVSEFALYQIEQEFRRTFPGLDVVCVVGDVKDEARLQ
QVFAAYRPALVFHAAAYKHVPLMESANAWEAVRNNVLGTWRVAMAARQAGVEKMVLISTD
KAVNPTNVMGTTKRMAERVVQSLEQAGGGTQFIVVRFGNVLGSNGSVIPTFREQIARGGP
VTVTHPDIIRYFMLIPEAAQLVLQAGLMGNGGEIFVLDMGEPVKIVDLARDLIRLSGFTE
EEIPIEFTGLRPGEKLYEELLADNEMTLPTPHAKLRVAKAESAPEEAWIGDLARWLETPP
ADVAGIKAGLARFVPEYRPQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory