SitesBLAST
Comparing Dsui_0521 FitnessBrowser__PS:Dsui_0521 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
35% identity, 98% coverage: 5:257/258 of query aligns to 6:258/259 of 5zaiC
- active site: A65 (≠ G64), F70 (= F69), S82 (≠ H83), R86 (≠ G87), G110 (= G111), E113 (= E114), P132 (= P133), E133 (≠ I134), I138 (≠ M141), P140 (= P143), G141 (= G144), A226 (≠ P222), F236 (≠ L235)
- binding coenzyme a: K24 (= K23), L25 (= L24), A63 (= A62), G64 (= G63), A65 (≠ G64), D66 (= D65), I67 (= I66), P132 (= P133), R166 (≠ I167), F248 (= F247), K251 (= K250)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
35% identity, 97% coverage: 5:255/258 of query aligns to 6:254/255 of 3q0jC
- active site: A65 (≠ G64), M70 (≠ F69), T80 (≠ H83), F84 (≠ G87), G108 (= G111), E111 (= E114), P130 (= P133), E131 (≠ I134), V136 (≠ F139), P138 (≠ M141), G139 (≠ Y142), L224 (≠ T224), F234 (= F234)
- binding acetoacetyl-coenzyme a: Q23 (≠ E22), A24 (≠ K23), L25 (= L24), A27 (= A26), A63 (= A62), G64 (= G63), A65 (≠ G64), D66 (= D65), I67 (= I66), K68 (≠ E67), M70 (≠ F69), F84 (≠ G87), G107 (= G110), G108 (= G111), E111 (= E114), P130 (= P133), E131 (≠ I134), P138 (≠ M141), G139 (≠ Y142), M140 (≠ P143)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
35% identity, 97% coverage: 5:255/258 of query aligns to 6:254/255 of 3q0gC
- active site: A65 (≠ G64), M70 (≠ F69), T80 (≠ H83), F84 (≠ G87), G108 (= G111), E111 (= E114), P130 (= P133), E131 (≠ I134), V136 (≠ F139), P138 (≠ M141), G139 (≠ Y142), L224 (≠ T224), F234 (= F234)
- binding coenzyme a: L25 (= L24), A63 (= A62), I67 (= I66), K68 (≠ E67), Y104 (≠ A107), P130 (= P133), E131 (≠ I134), L134 (= L137)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
35% identity, 97% coverage: 5:255/258 of query aligns to 5:253/256 of 3h81A
- active site: A64 (≠ G64), M69 (≠ F69), T79 (≠ H83), F83 (≠ G87), G107 (= G111), E110 (= E114), P129 (= P133), E130 (≠ I134), V135 (≠ F139), P137 (≠ M141), G138 (≠ Y142), L223 (≠ T224), F233 (= F234)
- binding calcium ion: F233 (= F234), Q238 (≠ Y240)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
36% identity, 97% coverage: 5:255/258 of query aligns to 5:249/250 of 3q0gD
- active site: A64 (≠ G64), M69 (≠ F69), T75 (≠ N75), F79 (≠ A79), G103 (= G111), E106 (= E114), P125 (= P133), E126 (≠ I134), V131 (≠ F139), P133 (≠ M141), G134 (≠ Y142), L219 (≠ T224), F229 (= F234)
- binding Butyryl Coenzyme A: F225 (≠ A230), F241 (= F247)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
35% identity, 99% coverage: 3:257/258 of query aligns to 3:256/257 of 6slbAAA
- active site: Q64 (≠ G64), F69 (= F69), L80 (= L80), N84 (≠ D84), A108 (≠ G111), S111 (≠ E114), A130 (≠ P133), F131 (≠ I134), L136 (≠ F139), P138 (≠ M141), D139 (≠ Y142), A224 (= A230), G234 (vs. gap)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ E58), A62 (= A62), Q64 (≠ G64), D65 (= D65), L66 (≠ I66), Y76 (≠ L76), A108 (≠ G111), F131 (≠ I134), D139 (≠ Y142)
1ef9A The crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 14:260/261 of 1ef9A
- active site: H66 (≠ G64), L71 (≠ F69), D82 (≠ H83), R86 (≠ G87), G110 (= G111), E113 (= E114), P133 (= P133), V138 (≠ F139), Y140 (≠ G144), N141 (≠ E145), E228 (vs. gap), Y238 (≠ L235)
- binding 2-carboxypropyl-coenzyme a: A64 (= A62), H66 (≠ G64), D67 (= D65), I68 (= I66), H69 (≠ E67), W108 (≠ I109), G110 (= G111), T132 (≠ A132), P133 (= P133), K253 (= K250)
P52045 Methylmalonyl-CoA decarboxylase; MMCD; Transcarboxylase; EC 4.1.1.- from Escherichia coli (strain K12) (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 14:260/261 of P52045
- G110 (= G111) binding
- T132 (≠ A132) binding
- K253 (= K250) binding
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
34% identity, 98% coverage: 5:257/258 of query aligns to 2:244/245 of 6slaAAA
- active site: Q61 (≠ G64), L68 (≠ V71), N72 (= N75), A96 (≠ G111), S99 (≠ E114), A118 (≠ P133), F119 (≠ I134), L124 (≠ F139), P126 (≠ M141), N127 (≠ Y142), A212 (= A230), G222 (vs. gap)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (= L24), A59 (= A62), Q61 (≠ G64), D62 (= D65), L63 (≠ I66), L68 (≠ V71), Y71 (≠ T74), A94 (≠ I109), G95 (= G110), A96 (≠ G111), F119 (≠ I134), I122 (≠ L137), L124 (≠ F139), N127 (≠ Y142), F234 (= F247), K237 (= K250)
6n97A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- amino(dethia)-coa (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 13:259/260 of 6n97A
- active site: H65 (≠ G64), L70 (≠ F69), G109 (= G111), E112 (= E114), P132 (= P133), V137 (≠ F139), Y139 (≠ G144), E227 (vs. gap), Y237 (≠ L235)
- binding (2R)-sulfonatepropionyl-amino(dethia)-CoA: L24 (= L24), K59 (≠ E58), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), W107 (≠ I109), G108 (= G110), G109 (= G111), T131 (≠ A132), P132 (= P133), L135 (= L137), Y139 (≠ G144), F249 (= F247), K252 (= K250)
- binding (2S)-sulfonatepropionyl-amino(dethia)-CoA: L24 (= L24), K59 (≠ E58), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), W107 (≠ I109), G108 (= G110), G109 (= G111), T131 (≠ A132), P132 (= P133), L135 (= L137), Y139 (≠ G144), F249 (= F247), K252 (= K250)
6n96A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- oxa(dethia)-coa (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 13:259/260 of 6n96A
- active site: H65 (≠ G64), L70 (≠ F69), G109 (= G111), E112 (= E114), P132 (= P133), V137 (≠ F139), Y139 (≠ G144), E227 (vs. gap), Y237 (≠ L235)
- binding (2~{S})-1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propane-2-sulfonic acid: K59 (≠ E58), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), H68 (≠ E67), W107 (≠ I109), G108 (= G110), G109 (= G111), T131 (≠ A132), P132 (= P133), L135 (= L137), V137 (≠ F139), Y139 (≠ G144), F249 (= F247), K252 (= K250)
- binding (2~{R})-1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propane-2-sulfonic acid: K59 (≠ E58), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), H68 (≠ E67), W107 (≠ I109), G108 (= G110), G109 (= G111), T131 (≠ A132), P132 (= P133), L135 (= L137), V137 (≠ F139), Y139 (≠ G144), F249 (= F247), K252 (= K250)
6n95A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- coa (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 13:259/260 of 6n95A
- active site: H65 (≠ G64), L70 (≠ F69), G109 (= G111), E112 (= E114), P132 (= P133), V137 (≠ F139), Y139 (≠ G144), E227 (vs. gap), Y237 (≠ L235)
- binding (2R)-sulfonatepropionyl-CoA: K23 (= K23), L24 (= L24), K59 (≠ E58), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), H68 (≠ E67), W107 (≠ I109), G108 (= G110), G109 (= G111), T131 (≠ A132), P132 (= P133), L135 (= L137), Y139 (≠ G144), F249 (= F247), K252 (= K250)
- binding (2S)-sulfonatepropionyl-CoA: K23 (= K23), L24 (= L24), K59 (≠ E58), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), H68 (≠ E67), W107 (≠ I109), G108 (= G110), G109 (= G111), T131 (≠ A132), P132 (= P133), L135 (= L137), V137 (≠ F139), Y139 (≠ G144), F249 (= F247), K252 (= K250)
6n94A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- amino(dethia)-coa (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 13:259/260 of 6n94A
- active site: H65 (≠ G64), L70 (≠ F69), G109 (= G111), E112 (= E114), P132 (= P133), V137 (≠ F139), Y139 (≠ G144), E227 (vs. gap), Y237 (≠ L235)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylamino]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: K23 (= K23), L24 (= L24), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), H68 (≠ E67), W107 (≠ I109), G108 (= G110), G109 (= G111), T131 (≠ A132), P132 (= P133), Y139 (≠ G144)
6n93A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- oxa(dethia)-coa (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 13:259/260 of 6n93A
- active site: H65 (≠ G64), L70 (≠ F69), G109 (= G111), E112 (= E114), P132 (= P133), V137 (≠ F139), Y139 (≠ G144), E227 (vs. gap), Y237 (≠ L235)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: L24 (= L24), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), H68 (≠ E67), W107 (≠ I109), T131 (≠ A132), L135 (= L137), F249 (= F247), K252 (= K250)
6n92F Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- coa (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 13:259/260 of 6n92F
- active site: H65 (≠ G64), L70 (≠ F69), G109 (= G111), E112 (= E114), P132 (= P133), V137 (≠ F139), Y139 (≠ G144), E227 (vs. gap), Y237 (≠ L235)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: R22 (≠ E22), K23 (= K23), L24 (= L24), A63 (= A62), H65 (≠ G64), D66 (= D65), S105 (≠ A107), W107 (≠ I109), W107 (≠ I109), G108 (= G110), G109 (= G111), T127 (≠ K129), F128 (= F130), S129 (≠ G131), T131 (≠ A132), P132 (= P133), Y139 (≠ G144), S164 (≠ R166), P165 (≠ I167), F249 (= F247)
- binding (2E)-2-(hydroxyimino)propanoic acid: E240 (≠ A238)
Sites not aligning to the query:
6n92A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- coa (see paper)
30% identity, 95% coverage: 13:257/258 of query aligns to 13:259/260 of 6n92A
- active site: H65 (≠ G64), L70 (≠ F69), G109 (= G111), E112 (= E114), P132 (= P133), V137 (≠ F139), Y139 (≠ G144), E227 (vs. gap), Y237 (≠ L235)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: L24 (= L24), A63 (= A62), H65 (≠ G64), D66 (= D65), I67 (= I66), H68 (≠ E67), W107 (≠ I109), G108 (= G110), G109 (= G111), T131 (≠ A132), P132 (= P133), Y139 (≠ G144), F249 (= F247), K252 (= K250)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
30% identity, 96% coverage: 9:256/258 of query aligns to 13:258/260 of 1dubA
- active site: A68 (≠ G64), M73 (≠ L70), S83 (≠ H83), L87 (≠ G87), G111 (= G111), E114 (= E114), P133 (= P133), E134 (≠ I134), T139 (≠ F139), P141 (≠ M141), G142 (≠ Y142), K227 (≠ P222), F237 (≠ L235)
- binding acetoacetyl-coenzyme a: K26 (≠ E22), A27 (≠ K23), L28 (= L24), A30 (= A26), A66 (= A62), A68 (≠ G64), D69 (= D65), I70 (= I66), Y107 (≠ A107), G110 (= G110), G111 (= G111), E114 (= E114), P133 (= P133), E134 (≠ I134), L137 (= L137), G142 (≠ Y142), F233 (≠ S231), F249 (= F247)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 96% coverage: 9:256/258 of query aligns to 43:288/290 of P14604
- E144 (= E114) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ I134) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
30% identity, 96% coverage: 9:256/258 of query aligns to 11:256/258 of 1ey3A
- active site: A66 (≠ G64), M71 (≠ L70), S81 (≠ H83), L85 (≠ G87), G109 (= G111), E112 (= E114), P131 (= P133), E132 (≠ I134), T137 (≠ F139), P139 (≠ M141), G140 (≠ Y142), K225 (≠ P222), F235 (≠ L235)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ E22), L26 (= L24), A28 (= A26), A64 (= A62), G65 (= G63), A66 (≠ G64), D67 (= D65), I68 (= I66), L85 (≠ G87), W88 (≠ L90), G109 (= G111), P131 (= P133), L135 (= L137), G140 (≠ Y142)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
30% identity, 96% coverage: 9:256/258 of query aligns to 13:258/260 of 2hw5C
- active site: A68 (≠ G64), M73 (≠ F69), S83 (≠ H83), L87 (≠ G87), G111 (= G111), E114 (= E114), P133 (= P133), E134 (≠ I134), T139 (≠ F139), P141 (≠ M141), G142 (≠ Y142), K227 (≠ P222), F237 (≠ L235)
- binding crotonyl coenzyme a: K26 (≠ E22), A27 (≠ K23), L28 (= L24), A30 (= A26), K62 (≠ E58), I70 (= I66), F109 (≠ I109)
Query Sequence
>Dsui_0521 FitnessBrowser__PS:Dsui_0521
MSGRILVSRDGDIATVTLSNPEKLNAVNYAMWCDLAAAMAELSADSSLRCVVLAGAGEAF
AAGGDIEEFLVKRTNLEQALHYHDKVGAALDAVRDCPHPTVALIRGACIGGGLEIAGNCD
LRIAGEGAKFGAPINRLGFSMYPGEMSGLLALAGPAVMSEILLEGRILSAAEAYAKGLLT
RVVADAQLEDEVTATARRIAAGAPLVARWHKQWMRRLASGAPLTQEEKAASFAFLDTADY
KEGLDAFLAKRKPAFKGC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory