Comparing Dsui_0602 FitnessBrowser__PS:Dsui_0602 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ag8A NADP complex of pyrroline-5-carboxylate reductase from neisseria meningitidis (see paper)
45% identity, 99% coverage: 1:266/270 of query aligns to 1:261/263 of 2ag8A
3triA Structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii (see paper)
40% identity, 97% coverage: 3:265/270 of query aligns to 5:269/272 of 3triA
5bshA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline (see paper)
38% identity, 96% coverage: 5:263/270 of query aligns to 13:271/272 of 5bshA
5bsgA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NADP+ (see paper)
38% identity, 96% coverage: 5:263/270 of query aligns to 13:271/272 of 5bsgA
5bsfA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NAD+ (see paper)
38% identity, 96% coverage: 5:263/270 of query aligns to 13:271/272 of 5bsfA
5bseA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) (see paper)
38% identity, 96% coverage: 5:263/270 of query aligns to 13:271/272 of 5bseA
2rcyA Crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with NADP bound
32% identity, 98% coverage: 1:264/270 of query aligns to 5:261/262 of 2rcyA
6xp0A Structure of human pycr1 complexed with n-formyl l-proline (see paper)
34% identity, 97% coverage: 1:263/270 of query aligns to 3:267/272 of 6xp0A
2izzA Crystal structure of human pyrroline-5-carboxylate reductase
34% identity, 97% coverage: 1:263/270 of query aligns to 2:269/272 of 2izzA
6xp3A Structure of human pycr1 complexed with cyclopentanecarboxylic acid (see paper)
34% identity, 97% coverage: 1:263/270 of query aligns to 4:271/276 of 6xp3A
P32322 Pyrroline-5-carboxylate reductase 1, mitochondrial; P5C reductase 1; P5CR 1; EC 1.5.1.2 from Homo sapiens (Human) (see 4 papers)
34% identity, 97% coverage: 1:263/270 of query aligns to 1:268/319 of P32322
Sites not aligning to the query:
6xp1B Structure of human pycr1 complexed with l-thiazolidine-2-carboxylate (see paper)
34% identity, 97% coverage: 1:263/270 of query aligns to 7:274/281 of 6xp1B
2graA Crystal structure of human pyrroline-5-carboxylate reductase complexed with NADP (see paper)
34% identity, 97% coverage: 1:263/270 of query aligns to 3:270/277 of 2graA
2gr9A Crystal structure of p5cr complexed with nadh (see paper)
34% identity, 97% coverage: 1:263/270 of query aligns to 3:270/277 of 2gr9A
5uatC Structure of human pycr-1 complexed with NADPH (see paper)
34% identity, 97% coverage: 1:263/270 of query aligns to 5:272/277 of 5uatC
5uauA Structure of human pycr-1 complexed with proline (see paper)
34% identity, 97% coverage: 1:263/270 of query aligns to 1:268/274 of 5uauA
5uavA Structure of human pycr-1 complexed with NADPH and l-tetrahydrofuroic acid (see paper)
34% identity, 97% coverage: 1:263/270 of query aligns to 5:272/278 of 5uavA
6xp2A Structure of human pycr1 complexed with l-thiazolidine-4-carboxylate (see paper)
35% identity, 80% coverage: 47:263/270 of query aligns to 42:261/267 of 6xp2A
Q96C36 Pyrroline-5-carboxylate reductase 2; P5C reductase 2; P5CR 2; EC 1.5.1.2 from Homo sapiens (Human) (see paper)
32% identity, 97% coverage: 1:263/270 of query aligns to 1:268/320 of Q96C36
2amfA Crystal structure of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes (see paper)
32% identity, 94% coverage: 1:253/270 of query aligns to 2:247/257 of 2amfA
>Dsui_0602 FitnessBrowser__PS:Dsui_0602
MKITFLGGGNMANALIGGLVNKGFAAGDIAVVELNADNRSKLEAAYGVRTFAGAEAAAWD
CDVIVLAVKPQSMKEAIAPIGPHLKDQLVVSIAAGLNLASLSRWLGGHRRLVRTMPNTPA
LIGAGVTGLYALPEVDAAGRAAAQRVLEAVGSAVWFADESQMDAVTAVSGSGPAYVFLFI
EALQQAGKDLGFDDEQARRLAIETVLGAAQLAAQSPDPASVLRERVTSKGGTTAAALAVM
ETAGVKAGIIAGVKAAEARGVELGQQLGAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory