SitesBLAST
Comparing Dsui_0609 FitnessBrowser__PS:Dsui_0609 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
38% identity, 95% coverage: 1:320/337 of query aligns to 1:318/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
38% identity, 95% coverage: 2:320/337 of query aligns to 1:317/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y137), R144 (= R148), Q145 (≠ S149), Y146 (≠ F150), S147 (= S151), H161 (= H165), V162 (≠ I166), V165 (= V169), G168 (= G172), V169 (≠ L173), A170 (≠ F174), T171 (= T175), T214 (= T214)
- binding fe2/s2 (inorganic) cluster: C34 (= C37), N35 (≠ R38), G37 (= G40), C39 (= C42), G40 (= G43), C42 (= C45), C74 (= C77)
Sites not aligning to the query:
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
30% identity, 93% coverage: 2:315/337 of query aligns to 1:307/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C37), S38 (≠ D39), W57 (≠ K58), Y135 (= Y137), R146 (= R148), A147 (≠ S149), Y148 (≠ F150), S149 (= S151), I162 (≠ H165), V163 (≠ I166), G169 (= G172), K170 (≠ L173), V171 (≠ F174), S172 (≠ T175), S209 (≠ T214)
- binding fe2/s2 (inorganic) cluster: Y34 (= Y35), C36 (= C37), N37 (≠ R38), G39 (= G40), C41 (= C42), G42 (= G43), C44 (= C45), C76 (= C77)
Sites not aligning to the query:
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
29% identity, 93% coverage: 3:315/337 of query aligns to 2:307/326 of Q03304
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
28% identity, 98% coverage: 3:333/337 of query aligns to 7:333/334 of 7c3bC
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
26% identity, 93% coverage: 20:334/337 of query aligns to 23:335/337 of 1krhA
- active site: C306 (= C304)
- binding flavin-adenine dinucleotide: Y143 (= Y137), R155 (= R148), S156 (= S149), Y157 (≠ F150), S158 (= S151), V171 (≠ H165), V172 (≠ I166), G178 (= G172), K179 (≠ L173), M180 (≠ F174), S181 (≠ T175), T219 (= T214), E332 (≠ D331), F334 (= F333), S335 (≠ T334)
- binding fe2/s2 (inorganic) cluster: M38 (≠ Y35), D39 (≠ G36), C40 (= C37), R41 (= R38), G43 (= G40), C45 (= C42), G46 (= G43), C48 (= C45), C82 (= C77)
Sites not aligning to the query:
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
26% identity, 98% coverage: 3:333/337 of query aligns to 6:320/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C37), S41 (≠ D39), W60 (≠ K58), R152 (= R148), A153 (≠ S149), Y154 (≠ F150), S155 (= S151), Y169 (≠ H165), I170 (= I166), G176 (= G172), R177 (≠ L173), F178 (= F174), S179 (≠ T175), A218 (≠ T214), F320 (= F333)
- binding fe2/s2 (inorganic) cluster: Y37 (= Y35), C39 (= C37), A40 (≠ R38), G42 (= G40), C44 (= C42), G45 (= G43), C47 (= C45), C80 (= C77)
Sites not aligning to the query:
8a1uF Sodium pumping nadh-quinone oxidoreductase with substrates nadh and q2 (see paper)
25% identity, 85% coverage: 47:333/337 of query aligns to 87:405/405 of 8a1uF
- binding flavin-adenine dinucleotide: Y166 (= Y137), R209 (= R148), A210 (≠ S149), Y211 (≠ F150), S212 (= S151), A230 (≠ V169), P233 (vs. gap), V239 (vs. gap), P240 (vs. gap), G242 (= G172), Q243 (≠ L173), M244 (≠ F174), A282 (≠ T214), F405 (= F333)
- binding fe2/s2 (inorganic) cluster: C110 (= C77)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S212 (= S151), R228 (= R167), G281 (= G213), A282 (≠ T214), G309 (= G240), R311 (= R242), S339 (= S270), F353 (≠ L284), C377 (= C304), G378 (= G305), P379 (≠ A306), M381 (= M309), M382 (≠ V310), D403 (= D331)
Sites not aligning to the query:
8a1yF Sodium pumping nadh-quinone oxidoreductase with inhibitor hqno (see paper)
25% identity, 85% coverage: 47:333/337 of query aligns to 88:406/408 of 8a1yF
- binding flavin-adenine dinucleotide: R210 (= R148), A211 (≠ S149), Y212 (≠ F150), S213 (= S151), V228 (≠ I166), R229 (= R167), A231 (≠ V169), V240 (vs. gap), P241 (vs. gap), G243 (= G172), Q244 (≠ L173), M245 (≠ F174)
- binding fe2/s2 (inorganic) cluster: C111 (= C77)
Sites not aligning to the query:
A5F5Y4 Na(+)-translocating NADH-quinone reductase subunit F; Na(+)-NQR subunit F; Na(+)-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F; EC 7.2.1.1 from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) (see paper)
25% identity, 85% coverage: 47:333/337 of query aligns to 88:406/408 of A5F5Y4
- C111 (= C77) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- R210 (= R148) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- Y212 (≠ F150) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- S246 (≠ T175) mutation to A: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
Sites not aligning to the query:
- 70 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 76 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 79 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
26% identity, 98% coverage: 3:333/337 of query aligns to 6:305/306 of 7c3bB
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
25% identity, 70% coverage: 99:333/337 of query aligns to 2:279/279 of 7qu0A
- binding ~{N}-[2,6-bis(fluoranyl)phenyl]ethanamide: S213 (= S270), F227 (≠ L284), M256 (= M309)
- binding flavin-adenine dinucleotide: Y40 (= Y137), R83 (= R148), A84 (≠ S149), Y85 (≠ F150), S86 (= S151), A104 (≠ V169), T105 (≠ P170), P106 (≠ G171), P107 (vs. gap), A113 (vs. gap), P114 (vs. gap), P115 (vs. gap), G116 (= G172), I117 (≠ L173), M118 (≠ F174), S119 (≠ T175), F279 (= F333)
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
25% identity, 70% coverage: 99:333/337 of query aligns to 2:279/279 of 7qtyA
- binding 1-(furan-2-ylmethyl)-3-(2-methylphenyl)thiourea: A184 (≠ N241), R185 (= R242), S213 (= S270), F227 (≠ L284), H229 (= H286), V255 (= V308), M256 (= M309)
- binding flavin-adenine dinucleotide: Y40 (= Y137), R83 (= R148), A84 (≠ S149), Y85 (≠ F150), S86 (= S151), N100 (≠ H165), A104 (≠ V169), T105 (≠ P170), P107 (vs. gap), A113 (vs. gap), P114 (vs. gap), G116 (= G172), I117 (≠ L173), M118 (≠ F174), S119 (≠ T175), F279 (= F333)
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
26% identity, 70% coverage: 99:333/337 of query aligns to 2:278/279 of 7qu3A
- binding flavin-adenine dinucleotide: Y40 (= Y137), R83 (= R148), A84 (≠ S149), Y85 (≠ F150), S86 (= S151), N100 (≠ H165), A104 (vs. gap), S105 (vs. gap), L112 (≠ V169), P113 (= P170), G115 (= G172), Q116 (≠ L173), M117 (≠ F174), S118 (≠ T175), A155 (≠ T214), F278 (= F333)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R167), G154 (= G213), G182 (= G240), F226 (≠ L284), I227 (≠ V285), P252 (≠ A306), M255 (= M309)
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
26% identity, 70% coverage: 99:333/337 of query aligns to 2:278/280 of 7qu5A
- binding flavin-adenine dinucleotide: Y40 (= Y137), R83 (= R148), A84 (≠ S149), Y85 (≠ F150), S86 (= S151), N100 (≠ H165), A104 (vs. gap), L112 (≠ V169), P113 (= P170), G115 (= G172), Q116 (≠ L173), M117 (≠ F174), S118 (≠ T175), A155 (≠ T214), F278 (= F333)
- binding gamma-Valerolactone: F19 (≠ D116), F68 (vs. gap), M70 (vs. gap), S105 (vs. gap), P108 (vs. gap), D196 (≠ A254), W207 (≠ Y265), H208 (≠ V266), L209 (≠ P267)
4u9uA Crystal structure of nqrf fad-binding domain from vibrio cholerae (see paper)
28% identity, 55% coverage: 148:333/337 of query aligns to 81:277/279 of 4u9uA
- binding flavin-adenine dinucleotide: R81 (= R148), A82 (≠ S149), Y83 (≠ F150), S84 (= S151), N98 (≠ H165), A102 (≠ V169), T103 (≠ P170), P104 (≠ G171), V111 (vs. gap), P112 (vs. gap), G114 (= G172), Q115 (≠ L173), M116 (≠ F174), S117 (≠ T175), F277 (= F333)
- binding magnesium ion: R186 (≠ A245), M188 (≠ L247)
- binding sodium ion: A198 (= A257), N201 (≠ H260), D202 (≠ S261), F204 (≠ I263)
Sites not aligning to the query:
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
29% identity, 60% coverage: 131:333/337 of query aligns to 43:244/250 of 1tvcA
- active site: Y63 (≠ F150), S64 (= S151), L215 (≠ V303)
- binding dihydroflavine-adenine dinucleotide: F49 (≠ Y137), R61 (= R148), S62 (= S149), Y63 (≠ F150), S64 (= S151), L78 (≠ H165), I79 (= I166), R80 (= R167), L82 (≠ V169), F87 (= F174), G128 (= G215), N155 (= N241), E159 (≠ A245), S186 (≠ A273), G187 (≠ A274), E242 (≠ D331), F244 (= F333)
Sites not aligning to the query:
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
26% identity, 55% coverage: 148:333/337 of query aligns to 86:288/289 of 2r6hC
- active site: C260 (= C304)
- binding flavin-adenine dinucleotide: R86 (= R148), A87 (≠ S149), Y88 (≠ F150), S89 (= S151), N103 (≠ H165), A107 (vs. gap), T108 (vs. gap), I122 (≠ V169), K123 (≠ P170), P124 (≠ G171), G125 (= G172), I126 (≠ L173), S127 (≠ F174), S128 (≠ T175), F288 (= F333)
Sites not aligning to the query:
6xtfD Crystal structure a thioredoxin reductase from gloeobacter violaceus bound to its electron donor (see paper)
41% identity, 23% coverage: 10:88/337 of query aligns to 12:88/96 of 6xtfD
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
25% identity, 55% coverage: 144:329/337 of query aligns to 55:242/243 of 2eixA
- active site: Y63 (≠ F150), T64 (≠ S151), C217 (= C304)
- binding flavin-adenine dinucleotide: R61 (= R148), P62 (≠ S149), Y63 (≠ F150), T64 (≠ S151), I78 (≠ H165), Y82 (≠ V169), K84 (≠ G171), G85 (= G172), M87 (≠ F174), S88 (≠ T175), T126 (= T214), T129 (≠ A217), F195 (≠ L284), M221 (≠ V308), A225 (= A312)
Sites not aligning to the query:
Query Sequence
>Dsui_0609 FitnessBrowser__PS:Dsui_0609
MSFSVTIEPGQHHFAAESDETILEAALRQGLTMPYGCRDGACGACKGKVLCGEVDHGKSQ
PHALSEADKAAGLTLFCCAKAKTDLTLECREVRSASDIPVKTLPSRIEKMEKVAADVMVL
HLRLPATERFQFLTGQYVDILLKDGKRRSFSLANAPHDDAFLQLHIRLVPGGLFTEHVFN
GMKERDILRLNGPHGSFFLREDSDKPMILLAGGTGFAPIKAIVEHALYTQSKRPMVIYWG
NRNKAGLYMDELPARWAAEHSHITYVPVLSEPAATDGWNGRTGLVHEAVMQDFPDLSGHQ
VYVCGAPVMVEAAKRDFTGRCGLPEAEFFADSFTFSS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory