Comparing Dsui_0630 FitnessBrowser__PS:Dsui_0630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
39% identity, 80% coverage: 44:392/434 of query aligns to 1:347/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
39% identity, 80% coverage: 44:392/434 of query aligns to 1:347/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
39% identity, 80% coverage: 44:392/434 of query aligns to 1:347/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
39% identity, 80% coverage: 44:392/434 of query aligns to 1:347/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
39% identity, 80% coverage: 44:392/434 of query aligns to 1:347/348 of 3ipcA
1uskA L-leucine-binding protein with leucine bound (see paper)
33% identity, 78% coverage: 46:383/434 of query aligns to 3:336/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
33% identity, 78% coverage: 46:383/434 of query aligns to 3:336/345 of 1usiA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
30% identity, 78% coverage: 46:383/434 of query aligns to 3:334/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
30% identity, 78% coverage: 46:383/434 of query aligns to 3:334/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
30% identity, 78% coverage: 46:383/434 of query aligns to 3:334/344 of 1z16A
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
34% identity, 56% coverage: 46:289/434 of query aligns to 3:243/345 of 4n0qB
Sites not aligning to the query:
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
31% identity, 77% coverage: 45:380/434 of query aligns to 1:341/350 of 3td9A
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
29% identity, 75% coverage: 68:391/434 of query aligns to 21:336/336 of 4mlcA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
29% identity, 75% coverage: 68:391/434 of query aligns to 21:335/335 of 4q6bA
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
30% identity, 75% coverage: 45:368/434 of query aligns to 2:321/348 of 4gnrA
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
26% identity, 79% coverage: 45:389/434 of query aligns to 3:371/376 of 4q6wA
4jb0A Rhodopseudomonas palustris (strain cga009) rp1789 transport protein (see paper)
29% identity, 51% coverage: 69:289/434 of query aligns to 17:236/367 of 4jb0A
Sites not aligning to the query:
4dqdA The crystal structure of a transporter in complex with 3-phenylpyruvic acid (see paper)
26% identity, 70% coverage: 46:347/434 of query aligns to 3:299/361 of 4dqdA
3sg0A The crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 (see paper)
26% identity, 70% coverage: 46:347/434 of query aligns to 4:300/361 of 3sg0A
4eyqA Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 in complex with caffeic acid/3-(4- hydroxy-phenyl)pyruvic acid (see paper)
29% identity, 51% coverage: 69:289/434 of query aligns to 20:239/361 of 4eyqA
Sites not aligning to the query:
>Dsui_0630 FitnessBrowser__PS:Dsui_0630
MRMNSIPGTILALAAAISLIGCGNKEEPAPQAAPAAAPAAKPEITVKIGHASPLTGPQAH
IGKDNEYGATLAIEELNAKGLEIGGAKVKFELISDDDQADPKQGTTVAQKFVDAKVNGVI
GHLNSGTTIPASKIYFDAGIPQISGSATNPTYTKQGFATAFRVMANDEQQGKALAQFAAK
TLAAKSVAIIDDRTAYGQGLADEFKKAAEAAGLKVVASEYTNDKATDFKAILTKIKSKKP
DLIFYGGMDPQGGPMAKQMKELGLKAKFLTGDGGCTPNFITLAGAAAEGQYCSLPGVPLD
KMPGGTVFKDKFVGKFKTEIQLYAPYVYDATMVLVDAMKRANSVEPAKYLPEIGKTSFQG
VTAKIGFDEFGDLKDGAISFYEYKGGKIEYVETLGGTPEAAPAAAPAEAPAAAAPAAAAP
ASASAPAAAAGEKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory