SitesBLAST
Comparing Dsui_0671 FitnessBrowser__PS:Dsui_0671 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
37% identity, 98% coverage: 3:289/292 of query aligns to 2:297/299 of 1cevA
- active site: H99 (= H90), D122 (= D114), H124 (= H116), D126 (= D118), H139 (= H131), D226 (= D218), D228 (= D220), E271 (= E263)
- binding manganese (ii) ion: H99 (= H90), D122 (= D114), D122 (= D114), H124 (= H116), D126 (= D118), D226 (= D218), D226 (= D218), D228 (= D220)
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
37% identity, 98% coverage: 3:289/292 of query aligns to 2:297/299 of P53608
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
37% identity, 98% coverage: 3:289/292 of query aligns to 1:296/298 of 5cevA
- active site: H98 (= H90), D121 (= D114), H123 (= H116), D125 (= D118), H138 (= H131), D225 (= D218), D227 (= D220), E270 (= E263)
- binding guanidine: H251 (≠ M244), E255 (≠ A248)
- binding lysine: S134 (= S127), H138 (= H131), E270 (= E263)
- binding manganese (ii) ion: H98 (= H90), D121 (= D114), D121 (= D114), H123 (= H116), D125 (= D118), D225 (= D218), D225 (= D218), D227 (= D220)
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
37% identity, 98% coverage: 3:289/292 of query aligns to 1:296/298 of 4cevA
- active site: H98 (= H90), D121 (= D114), H123 (= H116), D125 (= D118), H138 (= H131), D225 (= D218), D227 (= D220), E270 (= E263)
- binding guanidine: H251 (≠ M244), E255 (≠ A248)
- binding manganese (ii) ion: H98 (= H90), D121 (= D114), D121 (= D114), H123 (= H116), D125 (= D118), D225 (= D218), D225 (= D218), D227 (= D220)
- binding L-ornithine: H123 (= H116), D125 (= D118), S134 (= S127), H138 (= H131), D177 (≠ E170)
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
37% identity, 98% coverage: 3:289/292 of query aligns to 1:296/298 of 3cevA
- active site: H98 (= H90), D121 (= D114), H123 (= H116), D125 (= D118), H138 (= H131), D225 (= D218), D227 (= D220), E270 (= E263)
- binding arginine: H123 (= H116), D125 (= D118), S134 (= S127), H138 (= H131), D225 (= D218), H251 (≠ M244), E255 (≠ A248), E270 (= E263), E295 (≠ R288)
- binding manganese (ii) ion: H98 (= H90), D121 (= D114), D125 (= D118), D225 (= D218)
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
37% identity, 98% coverage: 3:289/292 of query aligns to 1:296/298 of 2cevB
- active site: H98 (= H90), D121 (= D114), H123 (= H116), D125 (= D118), H138 (= H131), D225 (= D218), D227 (= D220), E270 (= E263)
- binding guanidine: H251 (≠ M244), E255 (≠ A248)
- binding manganese (ii) ion: H98 (= H90), D121 (= D114), D121 (= D114), H123 (= H116), D125 (= D118), D225 (= D218), D225 (= D218), D227 (= D220)
6nbkA Crystal structure of arginase from bacillus cereus
35% identity, 98% coverage: 3:289/292 of query aligns to 1:287/289 of 6nbkA
6nfpA 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
34% identity, 98% coverage: 3:289/292 of query aligns to 1:290/292 of 6nfpA
6nfpD 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
35% identity, 99% coverage: 1:289/292 of query aligns to 2:287/289 of 6nfpD
6dktA Crystal structure of arginase from bacillus subtilis
35% identity, 98% coverage: 3:289/292 of query aligns to 1:281/283 of 6dktA
2ef5A Crystal structure of the arginase from thermus thermophilus
38% identity, 93% coverage: 17:289/292 of query aligns to 10:271/273 of 2ef5A
- active site: H80 (= H90), D102 (= D114), H104 (= H116), D106 (= D118), H118 (= H131), D200 (= D218), D202 (= D220), E245 (= E263)
- binding lysine: D15 (≠ H22), M16 (≠ A23), S19 (≠ T26)
- binding manganese (ii) ion: H80 (= H90), D102 (= D114), D102 (= D114), H104 (= H116), D106 (= D118), D200 (= D218), D200 (= D218), D202 (= D220)
Sites not aligning to the query:
6dktE Crystal structure of arginase from bacillus subtilis
33% identity, 98% coverage: 3:289/292 of query aligns to 1:266/268 of 6dktE
4iu5A Crystal structure of leishmania mexicana arginase in complex with catalytic product l-ornithine (see paper)
36% identity, 70% coverage: 63:266/292 of query aligns to 75:279/310 of 4iu5A
- active site: H102 (= H90), D125 (= D114), H127 (= H116), D129 (= D118), H142 (= H131), D231 (= D218), D233 (= D220), E276 (= E263)
- binding manganese (ii) ion: H102 (= H90), D125 (= D114), D125 (= D114), H127 (= H116), D129 (= D118), D231 (= D218), D231 (= D218), D233 (= D220)
- binding L-ornithine: H127 (= H116), D129 (= D118), S138 (= S127), H142 (= H131)
4iu4A Crystal structure of leishmania mexicana arginase in complex with inhibitor bec (see paper)
36% identity, 70% coverage: 63:266/292 of query aligns to 75:279/310 of 4iu4A
- active site: H102 (= H90), D125 (= D114), H127 (= H116), D129 (= D118), H142 (= H131), D231 (= D218), D233 (= D220), E276 (= E263)
- binding manganese (ii) ion: H102 (= H90), D125 (= D114), D125 (= D114), H127 (= H116), D129 (= D118), D231 (= D218), D231 (= D218), D233 (= D220)
- binding s-2-(boronoethyl)-l-cysteine: D125 (= D114), H127 (= H116), D129 (= D118), S138 (= S127), H142 (= H131), D182 (≠ E170), D231 (= D218), D233 (= D220), E276 (= E263)
4iu1A Crystal structure of leishmania mexicana arginase in complex with inhibitor nor-noha (see paper)
36% identity, 70% coverage: 63:266/292 of query aligns to 75:279/310 of 4iu1A
- active site: H102 (= H90), D125 (= D114), H127 (= H116), D129 (= D118), H142 (= H131), D231 (= D218), D233 (= D220), E276 (= E263)
- binding manganese (ii) ion: H102 (= H90), D125 (= D114), D125 (= D114), H127 (= H116), D129 (= D118), D231 (= D218), D231 (= D218), D233 (= D220)
- binding nor-n-omega-hydroxy-l-arginine: H127 (= H116), D129 (= D118), N131 (≠ H120), S138 (= S127), H142 (= H131), D182 (≠ E170), T245 (≠ S232)
4iu0A Crystal structure of leishmania mexicana arginase in complex with inhibitor abh (see paper)
36% identity, 70% coverage: 63:266/292 of query aligns to 75:279/310 of 4iu0A
- active site: H102 (= H90), D125 (= D114), H127 (= H116), D129 (= D118), H142 (= H131), D231 (= D218), D233 (= D220), E276 (= E263)
- binding 2(s)-amino-6-boronohexanoic acid: D125 (= D114), H127 (= H116), D129 (= D118), S138 (= S127), H142 (= H131), D231 (= D218), E276 (= E263)
- binding manganese (ii) ion: H102 (= H90), D125 (= D114), D125 (= D114), H127 (= H116), D129 (= D118), D231 (= D218), D231 (= D218), D233 (= D220)
5hjaA Crystal structure of leishmania mexicana arginase in complex with inhibitor abhdp (see paper)
32% identity, 90% coverage: 3:266/292 of query aligns to 1:279/303 of 5hjaA
- active site: H102 (= H90), D125 (= D114), H127 (= H116), D129 (= D118), H142 (= H131), D231 (= D218), D233 (= D220), E276 (= E263)
- binding manganese (ii) ion: H102 (= H90), D125 (= D114), D125 (= D114), H127 (= H116), D129 (= D118), D231 (= D218), D231 (= D218), D233 (= D220)
- binding (R)-2-amino-6-borono-2-(1-(3,4-dichlorobenzyl)piperidin-4-yl)hexanoic acid: H102 (= H90), D125 (= D114), H127 (= H116), D129 (= D118), S138 (= S127), H142 (= H131), G143 (= G132), A180 (≠ S168), V181 (≠ Y169), D182 (≠ E170), D231 (= D218), D233 (= D220)
5hj9A Crystal structure of leishmania mexicana arginase in complex with inhibitor abhpe (see paper)
32% identity, 90% coverage: 3:266/292 of query aligns to 1:279/311 of 5hj9A
- active site: H102 (= H90), D125 (= D114), H127 (= H116), D129 (= D118), H142 (= H131), D231 (= D218), D233 (= D220), E276 (= E263)
- binding manganese (ii) ion: H102 (= H90), D125 (= D114), D125 (= D114), H127 (= H116), D129 (= D118), D231 (= D218), D231 (= D218), D233 (= D220)
- binding [(5R)-5-amino-5-carboxy-7-(piperidin-1-yl)heptyl](trihydroxy)borate(1-): H102 (= H90), D125 (= D114), H127 (= H116), D129 (= D118), S138 (= S127), H142 (= H131), G143 (= G132), D182 (≠ E170), D231 (= D218), E276 (= E263)
4gszA Crystal structure of the zn2+5-human arginase i-abh complex (see paper)
31% identity, 97% coverage: 3:284/292 of query aligns to 2:291/313 of 4gszA
- active site: H97 (= H90), D120 (= D114), H122 (= H116), D124 (= D118), H137 (= H131), D228 (= D218), D230 (= D220), E273 (= E263)
- binding 2(s)-amino-6-boronohexanoic acid: D120 (= D114), H122 (= H116), D124 (= D118), S133 (= S127), H137 (= H131), G138 (= G132), D179 (≠ E170), D228 (= D218), T242 (≠ S232)
- binding zinc ion: H97 (= H90), H111 (≠ S104), D113 (≠ A106), D120 (= D114), D120 (= D114), H122 (= H116), D124 (= D118), H137 (= H131), D228 (= D218), D228 (= D218), D230 (= D220), E273 (= E263)
4fciA Crystal structure of the mn2+2-human arginase i-agpa complex (see paper)
31% identity, 97% coverage: 3:284/292 of query aligns to 2:291/313 of 4fciA
- active site: H97 (= H90), D120 (= D114), H122 (= H116), D124 (= D118), H137 (= H131), D228 (= D218), D230 (= D220), E273 (= E263)
- binding 2-amino-3-guanidino-propionic acid: H122 (= H116), D124 (= D118), N126 (≠ H120), S133 (= S127), H137 (= H131), D179 (≠ E170)
- binding manganese (ii) ion: H97 (= H90), D120 (= D114), D120 (= D114), H122 (= H116), D124 (= D118), D228 (= D218), D228 (= D218), D230 (= D220)
Query Sequence
>Dsui_0671 FitnessBrowser__PS:Dsui_0671
MHRTLRLIGAASGVGAQDPGCHAGPTALHRAHAFDDLQRRPDLSWGETLFPRQALGGRVA
EVADLCQRLAEAVRQARERGETPVVLGGDHSCAIGTWSGVRAASPAPVGLLWLDAHLDSH
TPESTHSGALHGMPLACLLGQGDRRLVTVGGPGPKLLPGHVALIGVRSYEPEEREFLDRL
GVRVFTIDEVRQRGLPAVFGEALARVRQAPGGYGVSLDLDVFDPREAPGVGSPEPAGLSQ
TELMPALAGLAGDPALLALEVMEFNPDRDAGGRTAALLARLIGAVFPRRHGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory