SitesBLAST
Comparing Dsui_0680 FitnessBrowser__PS:Dsui_0680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
40% identity, 83% coverage: 2:203/243 of query aligns to 6:195/254 of 3o4rA
- active site: G19 (= G15), S145 (= S149), F155 (≠ A160), Y158 (= Y164), K162 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G11), T17 (≠ A13), D18 (≠ R14), G19 (= G15), I20 (≠ L16), S39 (≠ G35), R40 (= R36), K41 (≠ R37), N44 (≠ P40), H65 (≠ D61), V66 (= V62), N92 (= N88), A94 (≠ G90), S145 (= S149), Y158 (= Y164), K162 (= K168), P188 (= P196), G189 (= G197), L190 (≠ W198), I191 (≠ C199), T193 (= T201), F195 (≠ M203)
Sites not aligning to the query:
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
40% identity, 83% coverage: 2:203/243 of query aligns to 30:219/278 of Q9BTZ2
- S176 (≠ M157) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ A160) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ I177) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
2zatA Crystal structure of a mammalian reductase (see paper)
37% identity, 83% coverage: 2:203/243 of query aligns to 3:192/251 of 2zatA
- active site: G16 (= G15), S142 (= S149), L152 (≠ A160), Y155 (= Y164), K159 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G11), T14 (≠ A13), D15 (≠ R14), G16 (= G15), I17 (≠ L16), S36 (≠ G35), R37 (= R36), K38 (≠ R37), N41 (≠ P40), H62 (≠ D61), N89 (= N88), A91 (≠ G90), V140 (= V147), S142 (= S149), Y155 (= Y164), K159 (= K168), P185 (= P196), G186 (= G197), I188 (≠ C199), T190 (= T201), F192 (≠ M203)
Sites not aligning to the query:
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
37% identity, 83% coverage: 2:203/243 of query aligns to 31:220/279 of Q8WNV7
- 37:61 (vs. 8:32, 48% identical) binding
- F177 (≠ M157) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (≠ A160) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y164) active site, Proton acceptor
- K187 (= K168) binding
- N196 (≠ I177) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
36% identity, 87% coverage: 2:212/243 of query aligns to 6:198/243 of 4i08A
- active site: G19 (= G15), N113 (= N121), S141 (= S149), Q151 (≠ W161), Y154 (= Y164), K158 (= K168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), S17 (≠ A13), R18 (= R14), I20 (≠ L16), T40 (≠ R36), N62 (≠ D61), V63 (= V62), N89 (= N88), A90 (= A89), G140 (≠ S148), S141 (= S149), Y154 (= Y164), K158 (= K168), P184 (= P196), G185 (= G197), T189 (= T201)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 87% coverage: 2:212/243 of query aligns to 6:202/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), S17 (≠ A13), R18 (= R14), I20 (≠ L16), T40 (≠ R36), N62 (≠ D61), V63 (= V62), N89 (= N88), A90 (= A89), I92 (≠ V91), V139 (= V147), S141 (= S149), Y154 (= Y164), K158 (= K168), P184 (= P196), G185 (= G197), I187 (≠ C199), T189 (= T201), M191 (= M203)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
37% identity, 83% coverage: 2:203/243 of query aligns to 2:188/255 of 2q2qD
- active site: G15 (= G15), S138 (= S149), Y151 (= Y164), K155 (= K168)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (≠ A13), S14 (≠ R14), G15 (= G15), I16 (≠ L16), F36 (≠ R36), D59 (= D61), L60 (≠ V62), N86 (= N88), G88 (= G90), L109 (≠ A116), I136 (≠ V147), S138 (= S149), Y151 (= Y164), K155 (= K168), P181 (= P196), G182 (= G197), W183 (= W198), V184 (≠ C199), T186 (= T201), L188 (≠ M203)
Sites not aligning to the query:
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
34% identity, 88% coverage: 1:214/243 of query aligns to 1:214/260 of 2ztlA
- active site: G15 (= G15), N114 (= N121), S142 (= S149), Y155 (= Y164), K159 (= K168), L200 (vs. gap)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ F92), S142 (= S149), H144 (≠ M151), K152 (≠ G159), Y155 (= Y164), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), G15 (= G15), I16 (≠ L16), F36 (≠ R36), L64 (≠ V62), N90 (= N88), A91 (= A89), G92 (= G90), L113 (≠ V109), Y155 (= Y164), K159 (= K168), P185 (= P196), W187 (= W198), V188 (≠ C199), T190 (= T201), V193 (vs. gap)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
34% identity, 88% coverage: 1:214/243 of query aligns to 1:214/260 of 1wmbA
Sites not aligning to the query:
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
35% identity, 83% coverage: 1:201/243 of query aligns to 1:190/236 of 1x1tA
- active site: G15 (= G15), N114 (= N121), S142 (= S149), Y155 (= Y164), K159 (= K168)
- binding cacodylate ion: S142 (= S149), H144 (≠ M151), Y155 (= Y164), W187 (= W198)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (≠ A13), S14 (≠ R14), G15 (= G15), I16 (≠ L16), G35 (= G35), F36 (≠ R36), D63 (= D61), L64 (≠ V62), N90 (= N88), G92 (= G90), L113 (≠ V109), S142 (= S149), Y155 (= Y164), K159 (= K168), P185 (= P196), W187 (= W198), V188 (≠ C199), T190 (= T201)
Sites not aligning to the query:
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
35% identity, 83% coverage: 2:203/243 of query aligns to 6:192/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G11), R18 (= R14), G19 (= G15), I20 (≠ L16), D39 (≠ R36), R40 (= R37), C63 (≠ A60), I65 (≠ V62), N91 (= N88), G93 (= G90), I94 (≠ V91), V114 (≠ A120), Y155 (= Y164), K159 (= K168), I188 (≠ C199), T190 (= T201)
Sites not aligning to the query:
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
35% identity, 83% coverage: 2:202/243 of query aligns to 7:195/259 of 6ci9D
- active site: G20 (= G15), S145 (= S149), Y159 (= Y164)
- binding 1-aminopropan-2-one: F97 (= F92), S145 (= S149), T147 (≠ M151), W156 (= W161), Y159 (= Y164), G190 (= G197)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G11), S18 (≠ A13), G20 (= G15), I21 (≠ L16), G40 (= G35), R41 (= R36), N42 (≠ R37), D66 (= D61), V67 (= V62), N93 (= N88), G95 (= G90), T143 (≠ V147), S145 (= S149), Y159 (= Y164), K163 (= K168), P189 (= P196), N191 (≠ W198), I192 (≠ C199), T194 (= T201)
Sites not aligning to the query:
5ha5D Crystal structure of an NAD-bound oxidoreductase from brucella ovis
36% identity, 84% coverage: 1:203/243 of query aligns to 3:192/244 of 5ha5D
- active site: G17 (= G15), S142 (= S149), Y155 (= Y164), K159 (= K168)
- binding nicotinamide-adenine-dinucleotide: G13 (= G11), R16 (= R14), G17 (= G15), L18 (= L16), D37 (≠ G35), I38 (≠ R36), L62 (≠ A60), D63 (= D61), V64 (= V62), N90 (= N88), A91 (= A89), S142 (= S149), Y155 (= Y164), K159 (= K168), G186 (= G197), M188 (≠ C199), S190 (≠ T201)
7w61A Crystal structure of farnesol dehydrogenase from helicoverpa armigera (see paper)
31% identity, 91% coverage: 5:226/243 of query aligns to 9:231/249 of 7w61A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), S17 (≠ A13), S18 (≠ R14), G19 (= G15), I20 (≠ L16), A39 (≠ G35), R40 (= R36), R41 (= R37), C63 (≠ A60), D64 (= D61), V65 (= V62), N91 (= N88), A92 (= A89), G93 (= G90), I94 (≠ V91), I119 (≠ A120), I147 (≠ V147), Y164 (= Y164), K168 (= K168), P196 (= P196), G197 (= G197), L198 (≠ W198), V199 (≠ C199), T201 (= T201), A202 (≠ E202), M203 (= M203)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 83% coverage: 2:203/243 of query aligns to 5:189/244 of 4nbuB
- active site: G18 (= G15), N111 (= N121), S139 (= S149), Q149 (≠ W161), Y152 (= Y164), K156 (= K168)
- binding acetoacetyl-coenzyme a: D93 (≠ E94), K98 (≠ L106), S139 (= S149), N146 (≠ T156), V147 (≠ M157), Q149 (≠ W161), Y152 (= Y164), F184 (≠ W198), M189 (= M203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G11), N17 (≠ R14), G18 (= G15), I19 (≠ L16), D38 (≠ G35), F39 (≠ R36), V59 (≠ A60), D60 (= D61), V61 (= V62), N87 (= N88), A88 (= A89), G89 (= G90), I90 (≠ V91), T137 (≠ V147), S139 (= S149), Y152 (= Y164), K156 (= K168), P182 (= P196), F184 (≠ W198), T185 (≠ C199), T187 (= T201), M189 (= M203)
Sites not aligning to the query:
3tzcA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae (see paper)
33% identity, 87% coverage: 2:212/243 of query aligns to 6:181/224 of 3tzcA
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
33% identity, 89% coverage: 2:217/243 of query aligns to 2:202/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), T13 (≠ A13), S14 (≠ R14), G15 (= G15), I16 (≠ L16), G35 (= G35), F36 (≠ R36), L60 (≠ V62), N86 (= N88), G88 (= G90), I89 (≠ V91), A137 (≠ S148), Y151 (= Y164), K155 (= K168), P181 (= P196), G182 (= G197), V184 (≠ C199), T186 (= T201)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 85% coverage: 5:211/243 of query aligns to 6:198/244 of P0AEK2
- GASR 12:15 (≠ GAAR 11:14) binding
- T37 (≠ R36) binding
- NV 59:60 (≠ DV 61:62) binding
- N86 (= N88) binding
- Y151 (= Y164) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YRASK 164:168) binding
- A154 (≠ S167) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K168) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ C199) binding
Sites not aligning to the query:
- 233 E→K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
36% identity, 85% coverage: 5:211/243 of query aligns to 5:197/243 of 1q7bA
- active site: G15 (= G15), E101 (≠ L113), S137 (= S149), Q147 (≠ W161), Y150 (= Y164), K154 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), S13 (≠ A13), R14 (= R14), T36 (≠ R36), N58 (≠ D61), V59 (= V62), N85 (= N88), A86 (= A89), G87 (= G90), I88 (≠ V91), S137 (= S149), Y150 (= Y164), K154 (= K168), P180 (= P196), G181 (= G197), I183 (≠ C199)
Sites not aligning to the query:
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
33% identity, 93% coverage: 2:226/243 of query aligns to 4:210/249 of 4bmsF
- active site: S137 (= S149), H147 (≠ W161), Y150 (= Y164), K154 (= K168), Q195 (≠ E213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), N15 (≠ A13), S16 (≠ R14), I18 (≠ L16), R38 (= R36), R39 (= R37), A59 (= A60), D60 (= D61), V61 (= V62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (≠ A120), S137 (= S149), Y150 (= Y164), K154 (= K168), G181 (= G197), I183 (≠ C199), T185 (= T201), I187 (≠ M203)
Query Sequence
>Dsui_0680 FitnessBrowser__PS:Dsui_0680
MLAQKIAVVTGAARGLGLAVAGLLAEQGCRVVLVGRREGPLQAACAELAGRGLAVAALVA
DVTRGEDVARLAAFLEREYGGVDILVNNAGVFLEPHDFADPASGSLLRVDPALVAATLEA
NTLAPLRLMQALVPLMRRRGWGRIVNVSSGMGQLSTMGGAWPGYRASKTALNALTRILAA
ELAAEGAAIKVNAVCPGWCRTEMGGSDAQRSAEEGARSILWAATLPDDGPSGGFFRDGQP
LDW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory