Comparing Dsui_0702 FitnessBrowser__PS:Dsui_0702 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
34% identity, 63% coverage: 47:148/161 of query aligns to 546:648/650 of O31645
Sites not aligning to the query:
O31644 Transcriptional regulator ManR; Mannose operon transcriptional activator; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see paper)
31% identity, 77% coverage: 10:133/161 of query aligns to 514:633/648 of O31644
Sites not aligning to the query:
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
26% identity, 89% coverage: 6:148/161 of query aligns to 2:141/143 of C0H3V2
>Dsui_0702 FitnessBrowser__PS:Dsui_0702
MDLIAKLLPPAHILLDLEASSKKRAFEQAGLLFENNLGIARATVFDSLFAREKLGSTGLG
QGVAIPHGRIKGLKEAAGAFMRLSAPVPFDSPDGKPVGLMFVLLVPEQATEQHLQILSEL
AQRFSDRAFREALGACDNTDDAHRLFTDWGNHAANLHQPAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory