SitesBLAST
Comparing Dsui_0736 FitnessBrowser__PS:Dsui_0736 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
27% identity, 20% coverage: 152:413/1292 of query aligns to 22:226/465 of 3pm9A
- active site: A149 (= A288), L159 (≠ T298)
- binding flavin-adenine dinucleotide: P69 (= P199), Q70 (≠ R200), G71 (= G201), G72 (= G202), N73 (≠ G203), T74 (= T204), G75 (= G205), L76 (≠ Y206), G79 (= G209), Q80 (≠ A210), L91 (≠ T222), L133 (≠ P272), G134 (≠ T273), A135 (≠ S274), C139 (≠ S278), T140 (≠ C279), G142 (= G281), G143 (= G282), S146 (≠ A285), T147 (≠ M286), A149 (= A288), G150 (= G289), E200 (= E384), G201 (= G385), I205 (= I389), I206 (= I390)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
24% identity, 29% coverage: 173:546/1292 of query aligns to 49:360/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R518), T337 (= T521), K348 (= K532)
- binding flavin-adenine dinucleotide: P75 (= P199), Q76 (≠ R200), G77 (= G201), G78 (= G202), N79 (≠ G203), T80 (= T204), G81 (= G205), M82 (≠ Y206), G85 (= G209), S86 (≠ A210), L139 (≠ P272), G140 (≠ T273), A141 (≠ S274), C145 (≠ S278), G149 (= G282), N150 (= N283), A152 (= A285), T153 (≠ M286), G157 (= G290), G207 (= G385), I212 (= I390)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
24% identity, 29% coverage: 173:546/1292 of query aligns to 49:360/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P199), G77 (= G201), G78 (= G202), N79 (≠ G203), T80 (= T204), G81 (= G205), G85 (= G209), S86 (≠ A210), L139 (≠ P272), G140 (≠ T273), A141 (≠ S274), C145 (≠ S278), H146 (≠ C279), G148 (= G281), G149 (= G282), N150 (= N283), A152 (= A285), T153 (≠ M286), A155 (= A288), E206 (= E384), G207 (= G385), I211 (= I389), I212 (= I390)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R518), T337 (= T521), K348 (= K532)
Sites not aligning to the query:
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
24% identity, 29% coverage: 173:546/1292 of query aligns to 49:360/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (= P199), G77 (= G201), G78 (= G202), N79 (≠ G203), T80 (= T204), G81 (= G205), G85 (= G209), S86 (≠ A210), L139 (≠ P272), G140 (≠ T273), A141 (≠ S274), C145 (≠ S278), H146 (≠ C279), G149 (= G282), N150 (= N283), A152 (= A285), T153 (≠ M286), A155 (= A288), G157 (= G290), E206 (= E384), G207 (= G385), I211 (= I389), I212 (= I390)
- binding d-malate: M82 (≠ Y206), R333 (= R518), T337 (= T521), K348 (= K532)
Sites not aligning to the query:
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
24% identity, 29% coverage: 173:546/1292 of query aligns to 49:360/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R518), T337 (= T521), K348 (= K532)
- binding flavin-adenine dinucleotide: P75 (= P199), G77 (= G201), G78 (= G202), N79 (≠ G203), T80 (= T204), G81 (= G205), M82 (≠ Y206), G85 (= G209), S86 (≠ A210), L139 (≠ P272), G140 (≠ T273), A141 (≠ S274), C145 (≠ S278), G149 (= G282), N150 (= N283), A152 (= A285), T153 (≠ M286), A155 (= A288), G157 (= G290), G207 (= G385), I212 (= I390)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
24% identity, 29% coverage: 173:546/1292 of query aligns to 50:361/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P199), G78 (= G201), G79 (= G202), N80 (≠ G203), T81 (= T204), G82 (= G205), M83 (≠ Y206), G86 (= G209), S87 (≠ A210), L140 (≠ P272), A142 (≠ S274), C146 (≠ S278), H147 (≠ C279), G150 (= G282), N151 (= N283), A153 (= A285), T154 (≠ M286), G208 (= G385), I212 (= I389), I213 (= I390)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
24% identity, 29% coverage: 173:546/1292 of query aligns to 102:413/521 of Q8N465
- S109 (≠ E180) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ I198) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G202) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V219) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L225) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V252) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A269) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A285) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P311) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G313) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ T507) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R518) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (= T521) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ A530) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K532) binding ; binding ; mutation to A: Loss of catalytic activity.
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
25% identity, 31% coverage: 148:544/1292 of query aligns to 17:345/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ Y206), R317 (= R518), W321 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P199), G70 (= G201), T71 (≠ G202), G72 (= G203), T73 (= T204), G74 (= G205), G78 (= G209), V79 (≠ A210), L90 (= L225), P132 (= P272), G133 (≠ T273), A134 (≠ S274), G140 (= G282), M141 (≠ N283), A143 (= A285), T144 (≠ M286), A146 (= A288), S147 (≠ G289), E200 (= E384), G201 (= G385), I206 (= I390), W321 (vs. gap), Y322 (vs. gap)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
33% identity, 8% coverage: 681:786/1292 of query aligns to 346:455/455 of 8jdeA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147, 200, 201, 206, 322
- binding lactic acid: 318
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
33% identity, 8% coverage: 681:786/1292 of query aligns to 346:455/455 of 8jduA
Sites not aligning to the query:
- binding 2-oxopentanoic acid: 318, 322
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147, 200, 201, 206, 322
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
33% identity, 8% coverage: 681:786/1292 of query aligns to 346:455/455 of 8jdtA
Sites not aligning to the query:
- binding 2-ketobutyric acid: 318
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147, 200, 201, 206, 322
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
33% identity, 8% coverage: 681:786/1292 of query aligns to 346:455/455 of 8jdxA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147, 200, 201, 206, 322
- binding 3-methyl-2-oxobutanoic acid: 318
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
33% identity, 8% coverage: 681:786/1292 of query aligns to 347:456/456 of 8jdsA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147, 200, 201, 206, 323
- binding pyruvic acid: 319
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
24% identity, 32% coverage: 132:544/1292 of query aligns to 1:347/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P199), G70 (= G201), T71 (≠ G202), G72 (= G203), T73 (= T204), G74 (= G205), G78 (= G209), V79 (≠ A210), L90 (= L225), P132 (= P272), G133 (≠ T273), A134 (≠ S274), G140 (= G282), M141 (≠ N283), A143 (= A285), T144 (≠ M286), A146 (= A288), S147 (≠ G289), E200 (= E384), G201 (= G385), I206 (= I390), Y324 (vs. gap)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R518), W323 (vs. gap)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
24% identity, 32% coverage: 132:544/1292 of query aligns to 1:347/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R518), W323 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P199), G70 (= G201), T71 (≠ G202), G72 (= G203), T73 (= T204), G74 (= G205), G78 (= G209), V79 (≠ A210), L90 (= L225), P132 (= P272), G133 (≠ T273), A134 (≠ S274), G140 (= G282), M141 (≠ N283), A143 (= A285), T144 (≠ M286), A146 (= A288), S147 (≠ G289), E200 (= E384), G201 (= G385), I206 (= I390)
Sites not aligning to the query:
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
24% identity, 32% coverage: 132:544/1292 of query aligns to 1:347/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R518), W323 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P199), G70 (= G201), T71 (≠ G202), G72 (= G203), T73 (= T204), G74 (= G205), G78 (= G209), V79 (≠ A210), L90 (= L225), P132 (= P272), G133 (≠ T273), A134 (≠ S274), G140 (= G282), M141 (≠ N283), A143 (= A285), T144 (≠ M286), A146 (= A288), S147 (≠ G289), E200 (= E384), G201 (= G385), I206 (= I390), Y324 (vs. gap)
Sites not aligning to the query:
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
24% identity, 32% coverage: 132:544/1292 of query aligns to 1:347/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P199), G70 (= G201), T71 (≠ G202), G72 (= G203), T73 (= T204), G74 (= G205), G78 (= G209), V79 (≠ A210), L90 (= L225), P132 (= P272), G133 (≠ T273), A134 (≠ S274), G140 (= G282), M141 (≠ N283), A143 (= A285), T144 (≠ M286), A146 (= A288), S147 (≠ G289), E200 (= E384), G201 (= G385), I206 (= I390)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R518), W323 (vs. gap)
Sites not aligning to the query:
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
24% identity, 32% coverage: 132:544/1292 of query aligns to 1:347/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P199), G70 (= G201), T71 (≠ G202), G72 (= G203), T73 (= T204), G74 (= G205), G78 (= G209), V79 (≠ A210), L90 (= L225), P132 (= P272), G133 (≠ T273), A134 (≠ S274), G140 (= G282), M141 (≠ N283), A143 (= A285), T144 (≠ M286), A146 (= A288), S147 (≠ G289), E200 (= E384), G201 (= G385), I206 (= I390)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R518)
Sites not aligning to the query:
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
24% identity, 32% coverage: 132:544/1292 of query aligns to 1:347/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P199), G70 (= G201), T71 (≠ G202), G72 (= G203), T73 (= T204), G74 (= G205), G78 (= G209), V79 (≠ A210), L90 (= L225), P132 (= P272), G133 (≠ T273), A134 (≠ S274), G140 (= G282), M141 (≠ N283), A143 (= A285), T144 (≠ M286), A146 (= A288), S147 (≠ G289), E200 (= E384), G201 (= G385), I206 (= I390), Y324 (vs. gap)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ Y206), R319 (= R518), W323 (vs. gap)
Sites not aligning to the query:
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 12% coverage: 165:313/1292 of query aligns to 59:201/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Query Sequence
>Dsui_0736 FitnessBrowser__PS:Dsui_0736
MTARLREIPYNYTSFSDREIVIRLLGEDMWRVLDELRAERVTGRSARMLYEVLGDIWVVQ
RNPYLEDDLLATPSRREALVQALRHRLAEVEKRRSESAGEDPERSRKVAQLVEAAHKAVD
RFEQRFIDTLMLRRKVLKTLTRHTRKDNVAFDGLARVSHVTDATDWRVEYPFVVLYPDTE
EEIGPLVRGCIELGLTIIPRGGGTGYTGGAVPLSPLSVVINTEKLIDIGPVEEIILPGHD
KPYATIRTSVGVVTDRVSEAASAAGRVFAVDPTSASASCIGGNIAMNAGGKKAVLWGTAL
DNLAWWKMVTPDGNWLEVERLNHNFGKIHEQEKVEFRLKRFDARSYKLLSEEVLTLPGAA
CRKTGLGKDVTDKFLGGVPGVQKEGTDGIIVAARWVLHKMPPVTRTVCLEFFGQVREAVP
SIVEITDYFKPGGEGHKAGVQLAGLEHLDERYVKAVGYATKAKRHGRPKMVLIGDIVGHD
ENAVMQAASDVVKMTNVRGAEGFIAITPETRKKFWLDRSRTAAISKHTNAFKVNEDVVIP
LPRMGDYCDGIERINIELSLQNKLDLCDALTEFFKGDLPVNSADTKLDKDVLIEDRRERA
LEHISDVRARWQWLLDNLDLPLAEAEQRFAEFGVVAGELTNRAANPTLFHRLQDYSVRAS
WKKELKEPLDNIFNGATYRPLSEKMAAVQKEVLRGRVFVALHMHAGDGNVHTNIPVNSDH
YEMLQTANRAVERIMHLARSLDGVISGEHGIGITKLEFLTDEEIGPFRAYKEKVDPEGRF
NKGKLMPGGDLHNAYTPSFSLLGAESLIMEQSEIGKIADSIKDCLRCGKCKPVCSTHVPR
ANLLYSPRNKILGTSLLIEAFLYEEQTRRGISLQHFDEFNDVADHCTVCHRCVKPCPVDI
DFGDVSVAMRNFLRKQGKKKLDPGKAATMWFLTMKDPATIKLARTMMIGWGYKLQRLGVK
LAKTFGLTQGIVQHPPATLGRPSVKAQVIHFINKPMPGNLPKRTSRALLDIEDDHVVPVI
RDPQKATEDSDAVFYFPGCGSERLFSQVGLATQAMLYETGAVTVLPPGYLCCGYPQNAAG
EEDKGQKIITDNRVLFHRVATTLNYLDIKTVIVSCGTCMDQLQKYEFEKIFPGCRLLDIH
EYLLEKGVKLEGVKGTQYMYHEPCHTPMKTYSGIKVVNDLMGQRVDLNDRCCGESGSFAL
SRPDISTQVRFRKQEEIEKGATKLRQDFGVQDQVKILTSCPSCLQGLSRYEPDADIQADY
IVVEMAKTLLGENWMAQYVQKANSGGIERVLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory