Comparing Dsui_0801 FitnessBrowser__PS:Dsui_0801 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
41% identity, 100% coverage: 1:295/296 of query aligns to 2:301/303 of 7p9lAAA
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
41% identity, 100% coverage: 1:295/296 of query aligns to 5:304/306 of 7p7wBBB
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
41% identity, 100% coverage: 1:295/296 of query aligns to 3:302/304 of 7p9pAAA
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
40% identity, 100% coverage: 1:295/296 of query aligns to 9:307/311 of 4db3A
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
42% identity, 100% coverage: 1:295/296 of query aligns to 1:299/303 of Q8ZPZ9
2ap1A Crystal structure of the putative regulatory protein
42% identity, 100% coverage: 1:295/296 of query aligns to 3:301/305 of 2ap1A
2qm1B Crystal structure of glucokinase from enterococcus faecalis
31% identity, 99% coverage: 3:295/296 of query aligns to 9:318/325 of 2qm1B
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
27% identity, 94% coverage: 5:282/296 of query aligns to 6:263/289 of 2gupA
Sites not aligning to the query:
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
28% identity, 77% coverage: 51:277/296 of query aligns to 140:374/406 of P50456
Sites not aligning to the query:
1z6rA Crystal structure of mlc from escherichia coli (see paper)
28% identity, 77% coverage: 51:277/296 of query aligns to 116:350/382 of 1z6rA
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
27% identity, 86% coverage: 40:294/296 of query aligns to 119:369/396 of 1z05A
1xc3A Structure of a putative fructokinase from bacillus subtilis (see paper)
28% identity, 98% coverage: 4:292/296 of query aligns to 5:281/295 of 1xc3A
3lm9A Crystal structure of fructokinase with adp and fructose bound in the active site (see paper)
28% identity, 98% coverage: 4:292/296 of query aligns to 5:281/294 of 3lm9A
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
26% identity, 86% coverage: 40:295/296 of query aligns to 42:300/306 of 5f7rA
Sites not aligning to the query:
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
25% identity, 99% coverage: 3:294/296 of query aligns to 4:284/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
25% identity, 99% coverage: 3:294/296 of query aligns to 4:284/293 of 6jdhA
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
26% identity, 86% coverage: 40:295/296 of query aligns to 123:384/396 of 5f7qE
Sites not aligning to the query:
2aa4A Crystal structure of escherichia coli putative n-acetylmannosamine kinase, new york structural genomics consortium
32% identity, 92% coverage: 3:274/296 of query aligns to 4:266/289 of 2aa4A
P45425 N-acetylmannosamine kinase; ManNAc kinase; N-acetyl-D-mannosamine kinase; EC 2.7.1.60 from Escherichia coli (strain K12) (see paper)
32% identity, 92% coverage: 3:274/296 of query aligns to 4:266/291 of P45425
2yi1A Crystal structure of n-acetylmannosamine kinase in complex with n- acetyl mannosamine 6-phosphate and adp. (see paper)
27% identity, 85% coverage: 3:253/296 of query aligns to 6:264/308 of 2yi1A
>Dsui_0801 FitnessBrowser__PS:Dsui_0801
MRLGIDLGGSKIEIIALGDDGRELLRRRVPTPRGDYGATLQAVAGLVREAEAALQMTGSV
GVGMPGSESILSGHIRNANSTCLIGQPLGRDLEALLQRPVRLANDANCFALSEAMDGAGR
GARCVFGVILGTGVGGGLVIDGQVLRGANGIAGEWGHIPLPGAGADDLPLPPCYCGRHGC
VETYLSGPALAADHQRHGGEAMEAAAIATAAATGDARCEAALQRYEARLARALATVMNIV
DPDVIVLGGGLSNLQRLYANVPRLWAPHVFSDHIATRLLPPVHGDSSGVRGAAWLW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory