Comparing Dsui_0927 FitnessBrowser__PS:Dsui_0927 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
5xecA Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
49% identity, 56% coverage: 46:117/128 of query aligns to 10:81/82 of 5xecA
2exvA Crystal structure of the f7a mutant of the cytochrome c551 from pseudomonas aeruginosa (see paper)
47% identity, 59% coverage: 42:116/128 of query aligns to 6:80/82 of 2exvA
P00099 Cytochrome c-551; Cytochrome C8; Cytochrome c551 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 4 papers)
48% identity, 55% coverage: 46:116/128 of query aligns to 32:102/104 of P00099
Sites not aligning to the query:
351cA Structure of cytochrome c551 from p. Aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms (see paper)
48% identity, 55% coverage: 46:116/128 of query aligns to 10:80/82 of 351cA
6kq1A Crystal structure of cytochrome c551 from pseudomonas sp. Strain mt-1.
49% identity, 59% coverage: 43:117/128 of query aligns to 5:81/82 of 6kq1A
Sites not aligning to the query:
5xecC Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
45% identity, 59% coverage: 41:116/128 of query aligns to 3:78/80 of 5xecC
5aurA Hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at n-terminal region (see paper)
44% identity, 60% coverage: 41:117/128 of query aligns to 3:82/83 of 5aurA
1corA Investigation of the solution conformation of cytochromE C-551 from pseudomonas stutzeri (see paper)
45% identity, 58% coverage: 43:116/128 of query aligns to 5:80/82 of 1corA
1cchA The solution conformation of cytochromE C-551 from p.Stutzeri zobell determined by nmr+ (see paper)
47% identity, 59% coverage: 43:117/128 of query aligns to 5:81/82 of 1cchA
2d0sA Crystal structure of the cytochrome c552 from moderate thermophilic bacterium, hydrogenophilus thermoluteolus (see paper)
44% identity, 59% coverage: 42:117/128 of query aligns to 4:78/79 of 2d0sA
1a56A Primary sequence and solution conformation of ferricytochromE C-552 from nitrosomonas europaea, nmr, mean structure refined with explicit hydrogen bond constraints (see paper)
43% identity, 61% coverage: 40:117/128 of query aligns to 2:80/81 of 1a56A
4xxlA Crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1 (see paper)
33% identity, 59% coverage: 42:117/128 of query aligns to 10:90/92 of 4xxlA
>Dsui_0927 FitnessBrowser__PS:Dsui_0927
MIYRLLMMGLVLSWGAVQAADNSASAARAFCDSGKLAKGAEIAVFRGCLGCHTVDSKRIG
PSYQEIAKKYPHTPDVVAQLAKKIRDGGKGNWGELSMPANPVSEAEAQTLAEWVLSLDEP
PARYSSNP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory