Comparing Dsui_0929 FitnessBrowser__PS:Dsui_0929 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
45% identity, 94% coverage: 2:224/238 of query aligns to 1:224/225 of 4ysbA
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
43% identity, 82% coverage: 1:194/238 of query aligns to 3:198/350 of 5ve5A
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
39% identity, 94% coverage: 2:224/238 of query aligns to 7:232/237 of 4chlB
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
39% identity, 94% coverage: 2:224/238 of query aligns to 23:248/254 of O95571
Sites not aligning to the query:
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 79% coverage: 2:190/238 of query aligns to 52:250/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
38% identity, 79% coverage: 2:190/238 of query aligns to 3:201/244 of 2gcuA
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
30% identity, 82% coverage: 7:202/238 of query aligns to 12:248/294 of 4yslA
Sites not aligning to the query:
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
30% identity, 82% coverage: 7:202/238 of query aligns to 12:248/294 of 4yskA
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
30% identity, 79% coverage: 4:192/238 of query aligns to 3:208/210 of 2xf4A
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
29% identity, 82% coverage: 9:202/238 of query aligns to 12:249/295 of 4efzA
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
26% identity, 96% coverage: 1:229/238 of query aligns to 5:251/336 of 3r2uB
Sites not aligning to the query:
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
25% identity, 96% coverage: 1:229/238 of query aligns to 3:263/348 of 3r2uA
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
28% identity, 76% coverage: 14:194/238 of query aligns to 14:202/202 of 7l0bA
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
28% identity, 71% coverage: 4:172/238 of query aligns to 5:198/473 of 3tp9A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
27% identity, 81% coverage: 3:194/238 of query aligns to 1:209/209 of 7ev5A
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 67% coverage: 15:173/238 of query aligns to 83:240/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
30% identity, 67% coverage: 14:173/238 of query aligns to 12:170/254 of 2q42A
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
28% identity, 67% coverage: 15:173/238 of query aligns to 13:174/260 of 1qh5B
Sites not aligning to the query:
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
28% identity, 67% coverage: 15:173/238 of query aligns to 13:174/260 of 1qh5A
Sites not aligning to the query:
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
28% identity, 67% coverage: 15:173/238 of query aligns to 13:174/260 of 1qh3A
Sites not aligning to the query:
>Dsui_0929 FitnessBrowser__PS:Dsui_0929
MFIFRQLRDSSSATYTYLIGSRASRAALLVDPVAEQSPLYLGLLGELELNLACVVDTHLH
SDHLSAAPTLIRHTGCLYAAGLCSGIGGTDRQLADGDSLDLADLHLEVLATPGHTPGCIT
LLWEDRLLTGDALLIGSCGATGEPGGNAGTHYDSVTRKLLPLPDELLVFPGHDRDGRRVS
CIGDERQGNPLFCGISRDEFMAQDRSQPMGERAEAMLAANRQGGGSVLRERSPVSPNN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory