Comparing Dsui_0984 FitnessBrowser__PS:Dsui_0984 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
66% identity, 97% coverage: 3:295/302 of query aligns to 29:321/325 of P35914
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
66% identity, 97% coverage: 3:295/302 of query aligns to 2:294/296 of 3mp3B
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
66% identity, 97% coverage: 3:295/302 of query aligns to 2:294/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
65% identity, 97% coverage: 3:295/302 of query aligns to 2:294/296 of 3mp5B
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
62% identity, 97% coverage: 3:295/302 of query aligns to 74:366/370 of Q8TB92
Sites not aligning to the query:
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
59% identity, 98% coverage: 7:301/302 of query aligns to 4:298/301 of P13703
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
57% identity, 92% coverage: 6:282/302 of query aligns to 3:279/283 of 1ydnA
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
38% identity, 95% coverage: 9:295/302 of query aligns to 10:295/305 of 6ndsA
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
26% identity, 78% coverage: 3:238/302 of query aligns to 18:247/399 of 6ktqA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
28% identity, 76% coverage: 8:238/302 of query aligns to 5:226/376 of O87198
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
27% identity, 76% coverage: 8:238/302 of query aligns to 5:220/314 of 2zyfA
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
26% identity, 76% coverage: 8:238/302 of query aligns to 4:219/347 of 3a9iA
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
27% identity, 76% coverage: 8:238/302 of query aligns to 5:218/312 of 2ztjA
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
27% identity, 40% coverage: 161:280/302 of query aligns to 161:273/453 of 2nx9B
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
25% identity, 76% coverage: 9:238/302 of query aligns to 14:221/370 of 3mi3A
Q53WI0 4-hydroxy-2-oxovalerate aldolase; HOA; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-oxopentanoate aldolase; EC 4.1.3.39; EC 4.1.3.43 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
23% identity, 90% coverage: 9:280/302 of query aligns to 13:268/347 of Q53WI0
Sites not aligning to the query:
4jn6C Crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 (see paper)
30% identity, 41% coverage: 154:276/302 of query aligns to 141:258/339 of 4jn6C
Sites not aligning to the query:
P9WMK5 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase; 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.43; EC 4.1.3.39 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 41% coverage: 154:276/302 of query aligns to 144:261/346 of P9WMK5
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
23% identity, 76% coverage: 9:238/302 of query aligns to 32:250/400 of 3ivtB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
23% identity, 76% coverage: 9:238/302 of query aligns to 37:255/418 of Q9Y823
Sites not aligning to the query:
>Dsui_0984 FitnessBrowser__PS:Dsui_0984
MPLPTHVKIVEVGPRDGLQNEKQVVPTAVKIELIERLAAAGLPAVEATSFVSPKWVPQMG
DNSEVLRGIRQQPGVAYPVLTPNLKGFDSAVEAGATEVAIFGAASEAFSQKNINCSIAES
LKRFEPIVSAASALEIKVRGYVSCVVGCPYEGAVAPEKAAEVAKILYDMGCYEVSLGDTI
GVGNPASVSRLLEACARHVPMAKLAGHYHDTYGMAVANIYASLQLGLAVFDASVAGLGGC
PYAKGASGNVATEDVVYLLEGLGISTGIDLQRLVEAGAFISAHLGRESASKAARALLAKC
AG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory