Comparing Dsui_0987 FitnessBrowser__PS:Dsui_0987 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
28% identity, 63% coverage: 30:226/311 of query aligns to 18:205/210 of 2xf4A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
28% identity, 62% coverage: 30:223/311 of query aligns to 16:203/209 of 7ev5A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
28% identity, 53% coverage: 65:230/311 of query aligns to 50:192/225 of 4ysbA
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
24% identity, 50% coverage: 24:179/311 of query aligns to 8:142/254 of 2q42A
Sites not aligning to the query:
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 48% coverage: 30:179/311 of query aligns to 76:212/324 of Q9SID3
Sites not aligning to the query:
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
36% identity, 37% coverage: 64:179/311 of query aligns to 49:144/259 of 8ewoA
Sites not aligning to the query:
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
31% identity, 46% coverage: 34:176/311 of query aligns to 44:162/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
31% identity, 46% coverage: 34:176/311 of query aligns to 28:146/237 of 4chlB
Sites not aligning to the query:
6n36A Beta-lactamase from chitinophaga pinensis
32% identity, 26% coverage: 68:149/311 of query aligns to 74:155/265 of 6n36A
Sites not aligning to the query:
2zo4A Crystal structure of metallo-beta-lactamase family protein ttha1429 from thermus thermophilus hb8 (see paper)
27% identity, 60% coverage: 37:222/311 of query aligns to 30:236/301 of 2zo4A
Q68D91 Acyl-coenzyme A thioesterase MBLAC2; Acyl-CoA thioesterase MBLAC2; Beta-lactamase MBLAC2; Metallo-beta-lactamase domain-containing protein 2; Palmitoyl-coenzyme A thioesterase MBLAC2; EC 3.1.2.2; EC 3.5.2.6 from Homo sapiens (Human) (see 3 papers)
24% identity, 49% coverage: 63:215/311 of query aligns to 74:236/279 of Q68D91
Sites not aligning to the query:
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
26% identity, 53% coverage: 37:200/311 of query aligns to 29:209/295 of 4efzA
1x8iA Crystal structure of the zinc carbapenemase cpha in complex with the antibiotic biapenem (see paper)
24% identity, 63% coverage: 18:214/311 of query aligns to 14:208/224 of 1x8iA
Sites not aligning to the query:
3iogA Crystal structure of cpha n220g mutant with inhibitor 18 (see paper)
24% identity, 63% coverage: 18:214/311 of query aligns to 14:208/227 of 3iogA
3iofA Crystal structure of cpha n220g mutant with inhibitor 10a (see paper)
24% identity, 63% coverage: 18:214/311 of query aligns to 14:208/227 of 3iofA
3faiA The di zinc carbapenemase cpha n220g mutant (see paper)
24% identity, 63% coverage: 18:214/311 of query aligns to 14:208/227 of 3faiA
6dr8A Metallo-beta-lactamase from cronobacter sakazakii (enterobacter sakazakii) harldq motif mutant s60/r118h/q121h/k254h
30% identity, 49% coverage: 28:178/311 of query aligns to 20:172/252 of 6dr8A
Sites not aligning to the query:
>Dsui_0987 FitnessBrowser__PS:Dsui_0987
MASSRSVAPPPRLPASLLVLERGWLSSNNVLCIEDEEAALVDSGYVTHAAQTLALVEKAL
DGRRLTRLINTHSHSDHIGGNAALKHATGCRVLVPAGMAATIAEWDEEALLLSPLGQQAA
RFQHDATLAAGDRLTLGGLEWQALAVPGHDMDALAYFNADQGILISGDALWQDGFGVIFA
ELLGGDGLRTTRQTLDMLAALPIRAVIPGHGAPFADIGESFERAYSRLAGFESSIERLAR
HALKVMLVFYLLEKRRVQRRELPGLIASLSFPRSVAARYLAMDEEETAEWLTADLLRAGV
LQEEEGWLVAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory