Comparing Dsui_0989 FitnessBrowser__PS:Dsui_0989 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
40% identity, 98% coverage: 8:387/387 of query aligns to 6:379/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 97% coverage: 8:384/387 of query aligns to 44:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 97% coverage: 8:384/387 of query aligns to 48:427/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
35% identity, 93% coverage: 11:371/387 of query aligns to 15:375/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
35% identity, 84% coverage: 11:335/387 of query aligns to 18:344/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
24% identity, 72% coverage: 19:298/387 of query aligns to 25:279/391 of 3ramA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
27% identity, 28% coverage: 188:294/387 of query aligns to 187:288/373 of 3rzaA
Sites not aligning to the query:
>Dsui_0989 FitnessBrowser__PS:Dsui_0989
MHLLSIPFLPELTALRRDIHAHPELAFDESRTADIVARELERYGIEVHRGIARTGVVGVL
RNGSSKRAIGLRADMDALPLEEKNEFPHRSRHEGKMHACGHDGHTALLLGAARWLAEQRN
FDGTVVFIFQPAEESEGGAAVMIEDGLFEKFPVDAVYGLHNWPGIPLGEMAIMPGPVMAG
TCAFEIAIRGHGCHAAMPHQGVDPIVAGSQLVQALQTVVSRTLHPCESAVVSVTQFHAGS
AWNIIPDDAILRGTIRTFKPEVQETVERAIERLVSGVAAATGAQIGVTFDHRYPPTVNSG
PETEVCRHAARAVLGHERVITDALPSMGAEDFAYMLREKPGCYVWLGNGPGTGGCTLHNP
HYDFNDEALAVGISYWVSLAETALKPV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory