SitesBLAST
Comparing Dsui_1003 FitnessBrowser__PS:Dsui_1003 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
63% identity, 97% coverage: 3:399/410 of query aligns to 4:388/392 of P33221
- EL 22:23 (= EL 21:22) binding
- E82 (= E81) binding
- R114 (= R114) binding
- K155 (= K161) binding
- SSGKGQ 160:165 (= SSGKGQ 166:171) binding
- G162 (= G168) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ N185) modified: N6-acetyllysine
- EGVV 195:198 (≠ EGFV 201:204) binding
- E203 (= E209) binding
- E267 (= E278) binding
- E279 (= E290) binding
- D286 (= D297) binding
- K355 (= K366) binding
- RR 362:363 (= RR 373:374) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
63% identity, 97% coverage: 3:399/410 of query aligns to 3:385/389 of 1kjiA
- active site: E114 (= E115), K154 (= K161), S159 (= S166), G161 (= G168), E264 (= E278), E276 (= E290), D283 (= D297), T284 (= T298), R360 (= R374)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R114), I152 (≠ V159), K154 (= K161), S159 (= S166), S160 (= S167), G161 (= G168), Q164 (= Q171), E192 (= E201), V195 (= V204), E200 (= E209), Q222 (= Q236), E264 (= E278), F266 (= F280), E276 (= E290)
- binding magnesium ion: E264 (= E278), E276 (= E290)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
63% identity, 97% coverage: 3:399/410 of query aligns to 3:385/389 of 1ez1A
- active site: E114 (= E115), K154 (= K161), S159 (= S166), G161 (= G168), E264 (= E278), E276 (= E290), D283 (= D297), T284 (= T298), R360 (= R374)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R114), I152 (≠ V159), K154 (= K161), S159 (= S166), S160 (= S167), G161 (= G168), E192 (= E201), V194 (≠ F203), V195 (= V204), F197 (= F206), E200 (= E209), Q222 (= Q236), E264 (= E278), F266 (= F280), E276 (= E290)
- binding glycinamide ribonucleotide: G20 (= G20), E21 (= E21), L22 (= L22), E81 (= E81), I82 (= I82), S160 (= S167), D283 (= D297), K352 (= K366), R359 (= R373), R360 (= R374)
- binding magnesium ion: E264 (= E278), E276 (= E290)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
63% identity, 97% coverage: 3:399/410 of query aligns to 3:385/389 of 1eyzA
- active site: E114 (= E115), K154 (= K161), S159 (= S166), G161 (= G168), E264 (= E278), E276 (= E290), D283 (= D297), T284 (= T298), R360 (= R374)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R114), I152 (≠ V159), K154 (= K161), S159 (= S166), S160 (= S167), G161 (= G168), Q164 (= Q171), E192 (= E201), V195 (= V204), F197 (= F206), E200 (= E209), E264 (= E278), F266 (= F280), E276 (= E290)
- binding magnesium ion: E264 (= E278), E276 (= E290)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
63% identity, 97% coverage: 3:399/410 of query aligns to 3:382/386 of 1kjjA
- active site: E114 (= E115), K154 (= K161), S159 (= S166), G161 (= G168), E261 (= E278), E273 (= E290), D280 (= D297), T281 (= T298), R357 (= R374)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R114), I152 (≠ V159), K154 (= K161), S159 (= S166), S160 (= S167), G161 (= G168), Q164 (= Q171), E189 (= E201), V192 (= V204), E197 (= E209), Q219 (= Q236), E261 (= E278), F263 (= F280), E273 (= E290)
- binding magnesium ion: E261 (= E278), E273 (= E290)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
63% identity, 97% coverage: 3:399/410 of query aligns to 3:382/386 of 1kj8A
- active site: E114 (= E115), K154 (= K161), S159 (= S166), G161 (= G168), E261 (= E278), E273 (= E290), D280 (= D297), T281 (= T298), R357 (= R374)
- binding adenosine-5'-triphosphate: R113 (= R114), I152 (≠ V159), K154 (= K161), S159 (= S166), S160 (= S167), G161 (= G168), Q164 (= Q171), E189 (= E201), V192 (= V204), F194 (= F206), E197 (= E209), Q219 (= Q236), G222 (= G239), E261 (= E278), F263 (= F280), E273 (= E290)
- binding glycinamide ribonucleotide: G20 (= G20), E21 (= E21), L22 (= L22), E81 (= E81), I82 (= I82), S160 (= S167), D280 (= D297), K349 (= K366), R356 (= R373)
- binding magnesium ion: E261 (= E278), E273 (= E290)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
62% identity, 97% coverage: 3:399/410 of query aligns to 3:384/388 of 1kjqA
- active site: E114 (= E115), K154 (= K161), E263 (= E278), E275 (= E290), D282 (= D297), T283 (= T298), R359 (= R374)
- binding adenosine-5'-diphosphate: R113 (= R114), I152 (≠ V159), K154 (= K161), E191 (= E201), V193 (≠ F203), V194 (= V204), F196 (= F206), E199 (= E209), Q221 (= Q236), F265 (= F280), E275 (= E290)
- binding magnesium ion: E263 (= E278), E275 (= E290)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
48% identity, 97% coverage: 3:399/410 of query aligns to 8:408/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
46% identity, 97% coverage: 3:399/410 of query aligns to 10:397/409 of 2dwcB
- active site: E265 (= E278), E277 (= E290), D284 (= D297), T285 (= T298), R372 (= R374)
- binding adenosine-5'-diphosphate: R120 (= R114), H159 (≠ V159), K161 (= K161), H190 (≠ F203), I191 (≠ V204), F193 (= F206), E196 (= E209), F267 (= F280), E277 (= E290)
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 91% coverage: 21:392/410 of query aligns to 19:367/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (= R114), K148 (= K161), Y154 (≠ S166), D155 (≠ S167), G156 (= G168), Q159 (= Q171), E183 (= E201), W185 (≠ F203), V186 (= V204), F188 (= F206), E191 (= E209), H214 (≠ Q236), N217 (≠ G239), E256 (= E278), F258 (= F280), E269 (= E290)
- binding carbonate ion: R273 (= R294), H275 (= H296), N276 (≠ D297)
- binding magnesium ion: T105 (= T111), E111 (≠ R118), E256 (= E278), E269 (= E290), L270 (≠ V291)
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 91% coverage: 21:392/410 of query aligns to 18:366/380 of 4dlkA
- active site: Y153 (≠ S166), G155 (= G168), E255 (= E278), E268 (= E290), N275 (≠ D297), S276 (≠ T298), K348 (≠ R374)
- binding adenosine-5'-triphosphate: E76 (= E81), F77 (≠ I82), R107 (= R114), K147 (= K161), Y153 (≠ S166), D154 (≠ S167), G155 (= G168), Q158 (= Q171), W184 (≠ F203), V185 (= V204), F187 (= F206), E190 (= E209), E255 (= E278), F257 (= F280), N267 (≠ S289), E268 (= E290), R272 (= R294), H274 (= H296), N275 (≠ D297), K340 (= K366), R347 (= R373), K348 (≠ R374)
- binding calcium ion: E255 (= E278), E268 (= E290)
- binding phosphate ion: Q47 (= Q50), A49 (= A52)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 91% coverage: 21:392/410 of query aligns to 18:366/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (= R114), K147 (= K161), Q158 (= Q171), W184 (≠ F203), V185 (= V204), F187 (= F206), E190 (= E209), N216 (≠ G239), F257 (= F280), N267 (≠ S289), E268 (= E290)
- binding 5-aminoimidazole ribonucleotide: Q18 (≠ E21), L19 (= L22), E76 (= E81), Y153 (≠ S166), R272 (= R294), K340 (= K366), R347 (= R373)
Sites not aligning to the query:
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 91% coverage: 21:392/410 of query aligns to 18:366/377 of 3q2oB
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
30% identity, 91% coverage: 21:392/410 of query aligns to 17:365/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (= R114), K146 (= K161), Y152 (≠ S166), G154 (= G168), Q157 (= Q171), W183 (≠ F203), V184 (= V204), E189 (= E209), N215 (≠ G239), F256 (= F280), N266 (≠ S289), E267 (= E290)
- binding carbonate ion: R271 (= R294), H273 (= H296), N274 (≠ D297)
3k5hA Crystal structure of carboxyaminoimidazole ribonucleotide synthase from asperigillus clavatus complexed with atp (see paper)
27% identity, 87% coverage: 31:388/410 of query aligns to 24:367/382 of 3k5hA
- active site: Y152 (≠ S166), G154 (= G168), E254 (= E278), E267 (= E290), N274 (≠ D297), S275 (≠ T298), K353 (≠ R374)
- binding adenosine-5'-triphosphate: K104 (≠ R114), K146 (= K161), Y152 (≠ S166), D153 (≠ S167), G154 (= G168), N157 (≠ Q171), E181 (= E201), W183 (≠ F203), A184 (≠ V204), F186 (= F206), E189 (= E209), E254 (= E278), F256 (= F280), E267 (= E290)
- binding magnesium ion: E254 (= E278), E267 (= E290)
3k5iA Crystal structure of n5-carboxyaminoimidazole synthase from aspergillus clavatus in complex with adp and 5-aminoimadazole ribonucleotide (see paper)
27% identity, 87% coverage: 31:388/410 of query aligns to 24:367/381 of 3k5iA
- active site: E254 (= E278), E267 (= E290), N274 (≠ D297), S275 (≠ T298), K353 (≠ R374)
- binding adenosine-5'-diphosphate: K104 (≠ R114), K146 (= K161), Y152 (≠ S166), D153 (≠ S167), G154 (= G168), W183 (≠ F203), A184 (≠ V204), F186 (= F206), E189 (= E209), Q211 (= Q236), S214 (≠ G239), E267 (= E290)
- binding 5-aminoimidazole ribonucleotide: E73 (= E81), I74 (= I82), Y152 (≠ S166), D153 (≠ S167), R155 (≠ K169), R271 (= R294), K345 (= K366), R352 (= R373)
- binding magnesium ion: E254 (= E278), E267 (= E290)
Sites not aligning to the query:
4ma0A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with partially hydrolysed atp
29% identity, 75% coverage: 13:321/410 of query aligns to 2:290/366 of 4ma0A
- active site: Y144 (≠ S166), G146 (= G168), E247 (= E278), E259 (= E290), N266 (≠ D297), S267 (≠ T298)
- binding adenosine monophosphate: I136 (≠ V159), K138 (= K161), E175 (= E201), A176 (≠ G202), F177 (= F203), V178 (= V204), E183 (= E209), H206 (= H234), F249 (= F280), E259 (= E290)
Sites not aligning to the query:
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
29% identity, 75% coverage: 13:321/410 of query aligns to 2:290/373 of 4mamA
- active site: Y144 (≠ S166), G146 (= G168), E247 (= E278), E259 (= E290), N266 (≠ D297), S267 (≠ T298)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R114), I136 (≠ V159), K138 (= K161), Y144 (≠ S166), G146 (= G168), Q149 (= Q171), E175 (= E201), F177 (= F203), V178 (= V204), F180 (= F206), E183 (= E209), H206 (= H234), F249 (= F280), E259 (= E290)
Sites not aligning to the query:
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
29% identity, 75% coverage: 13:321/410 of query aligns to 2:290/365 of 5jqwA
- active site: Y144 (≠ S166), G146 (= G168), E247 (= E278), E259 (= E290), N266 (≠ D297), S267 (≠ T298)
- binding adenosine-5'-diphosphate: R98 (= R114), K138 (= K161), G143 (≠ S165), Y144 (≠ S166), D145 (≠ S167), G146 (= G168), V178 (= V204), E183 (= E209), H206 (= H234), F249 (= F280), E259 (= E290)
Sites not aligning to the query:
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
26% identity, 91% coverage: 31:402/410 of query aligns to 21:357/360 of 3ax6A
- active site: E231 (= E278), E244 (= E290), N251 (≠ D297), S252 (≠ T298), K330 (≠ R374)
- binding adenosine-5'-diphosphate: K101 (≠ R114), V136 (= V159), K138 (= K161), E164 (= E201), F166 (= F203), V167 (= V204), E172 (= E209), F233 (= F280), N243 (≠ S289)
Query Sequence
>Dsui_1003 FitnessBrowser__PS:Dsui_1003
MRIGTPLSPSATKVMLLGAGELGKEVIIALQRLGVEVIAVDRYADAPGMQVAHRSHVISM
TDGAALRRLIELEKPHLVVPEIEAIATDTLVEIEAEGLAQVIPTALAAKLTMNREGIRRL
AAEELGLPTSPYRFADSLAELQAAIDGTGEEKGIGYPCVVKPVMSSSGKGQSLLKGPADV
EKAWNHAQAGGRVQQSRVIVEGFVKFDYEITQLTVRAVGSSGQVETFFCEPIGHIQVDGD
YVESWQPQPMSEAAREKSREIAEKVTSNLGGRGIFGVELFIKGDQVWFSEVSPRPHDTGL
VTLTSQRLSEFELHARAILGLPVDASLRTPGASAVIYGGLEEQGVAYEGVAEALQVPTAD
LRLFGKPESFKKRRMGVALATGGSIEQARQRASLAASRVTPVSGKPATKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory