SitesBLAST
Comparing Dsui_1040 FitnessBrowser__PS:Dsui_1040 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
51% identity, 98% coverage: 4:301/303 of query aligns to 12:300/308 of P27305
- E55 (= E47) binding
- Y182 (= Y183) binding
- R200 (= R201) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
52% identity, 98% coverage: 6:301/303 of query aligns to 2:286/290 of 4a91A
- active site: S11 (= S15), K229 (= K242)
- binding glutamic acid: R7 (= R11), A9 (= A13), S11 (= S15), E43 (= E47), Y170 (= Y183), R188 (= R201), L192 (= L205)
- binding zinc ion: C99 (= C103), C101 (= C105), Y113 (= Y125), C117 (= C129)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
37% identity, 86% coverage: 9:270/303 of query aligns to 4:283/485 of Q8DLI5
- R6 (= R11) binding
- Y192 (= Y183) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
37% identity, 86% coverage: 9:270/303 of query aligns to 3:282/484 of 2cfoA
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
35% identity, 85% coverage: 9:266/303 of query aligns to 4:268/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
35% identity, 85% coverage: 9:266/303 of query aligns to 4:268/471 of P04805
- C98 (= C103) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C105) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C129) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ S131) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ L133) mutation to Q: No change in activity or in zinc content.
- H131 (vs. gap) mutation to Q: No change in activity or in zinc content.
- H132 (vs. gap) mutation to Q: No change in activity or in zinc content.
- C138 (≠ R140) mutation to S: No change in activity or in zinc content.
- S239 (= S241) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
38% identity, 80% coverage: 9:249/303 of query aligns to 4:232/380 of 4g6zA
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
33% identity, 85% coverage: 9:266/303 of query aligns to 3:281/485 of 4griB
- active site: S9 (= S15), K253 (= K242)
- binding glutamic acid: R5 (= R11), A7 (= A13), S9 (= S15), E41 (= E47), Y194 (= Y183), R212 (= R201), W216 (≠ L205)
- binding zinc ion: C105 (= C103), C107 (= C105), Y128 (= Y125), C132 (= C129)
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
34% identity, 79% coverage: 11:250/303 of query aligns to 5:254/468 of 1g59A
- binding : D44 (= D50), R45 (≠ G51), A46 (≠ P52), R47 (= R53), P109 (≠ R107), V145 (≠ A141), R163 (≠ L158), V166 (= V161), E172 (≠ D168), V177 (= V173), K180 (≠ R176), S181 (≠ A177), D182 (= D178), E207 (≠ A203), E208 (≠ D204), R237 (≠ T233), K241 (≠ G237), T242 (≠ E238), K243 (= K239)
Sites not aligning to the query:
- binding : 273, 274, 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
34% identity, 79% coverage: 11:250/303 of query aligns to 5:254/468 of 2cv2A
- active site: K246 (= K242)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R11), A7 (= A13), S9 (= S15), G17 (= G23), I21 (≠ A27), E41 (= E47), Y187 (= Y183), R205 (= R201), A206 (≠ G202), E208 (≠ D204), W209 (≠ L205), L235 (= L231), L236 (≠ A232)
- binding : S9 (= S15), T43 (≠ V49), D44 (= D50), R47 (= R53), V145 (≠ A141), R163 (≠ L158), Y168 (≠ H163), E172 (≠ D168), V177 (= V173), K180 (≠ R176), S181 (≠ A177), Y187 (= Y183), E207 (≠ A203), E208 (≠ D204), W209 (≠ L205), V211 (≠ D207), R237 (≠ T233), K241 (≠ G237)
Sites not aligning to the query:
- binding : 272, 273, 274, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
34% identity, 79% coverage: 11:250/303 of query aligns to 5:254/468 of 2cv1A
- active site: K246 (= K242)
- binding adenosine-5'-triphosphate: P8 (= P14), S9 (= S15), G17 (= G23), T18 (≠ S24), I21 (≠ A27), R47 (= R53), A206 (≠ G202), W209 (≠ L205), L235 (= L231), L236 (≠ A232)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R11), A7 (= A13), E41 (= E47), Y187 (= Y183), R205 (= R201), W209 (≠ L205)
- binding : S9 (= S15), E41 (= E47), T43 (≠ V49), D44 (= D50), R47 (= R53), V145 (≠ A141), R163 (≠ L158), V166 (= V161), E172 (≠ D168), V177 (= V173), K180 (≠ R176), S181 (≠ A177), Y187 (= Y183), E207 (≠ A203), E208 (≠ D204), W209 (≠ L205), V211 (≠ D207), R237 (≠ T233), K241 (≠ G237), K243 (= K239)
Sites not aligning to the query:
- binding : 273, 274, 276, 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
34% identity, 79% coverage: 11:250/303 of query aligns to 5:254/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
34% identity, 79% coverage: 11:250/303 of query aligns to 5:254/468 of 1n78A
- active site: K246 (= K242)
- binding glutamol-amp: R5 (= R11), A7 (= A13), P8 (= P14), S9 (= S15), G17 (= G23), T18 (≠ S24), I21 (≠ A27), E41 (= E47), Y187 (= Y183), N191 (≠ V187), R205 (= R201), A206 (≠ G202), E208 (≠ D204), W209 (≠ L205), L235 (= L231), L236 (≠ A232)
- binding : S9 (= S15), T43 (≠ V49), D44 (= D50), R47 (= R53), V145 (≠ A141), R163 (≠ L158), V166 (= V161), Y168 (≠ H163), E172 (≠ D168), V177 (= V173), K180 (≠ R176), S181 (≠ A177), Y187 (= Y183), E207 (≠ A203), E208 (≠ D204), W209 (≠ L205), L210 (= L206), V211 (≠ D207), R237 (≠ T233), K241 (≠ G237)
Sites not aligning to the query:
- binding : 273, 274, 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
34% identity, 79% coverage: 11:250/303 of query aligns to 5:254/468 of 1j09A
- active site: K246 (= K242)
- binding adenosine-5'-triphosphate: H15 (= H21), E208 (≠ D204), L235 (= L231), L236 (≠ A232), K243 (= K239), I244 (≠ L240), S245 (= S241), K246 (= K242), R247 (≠ Q243)
- binding glutamic acid: R5 (= R11), A7 (= A13), S9 (= S15), E41 (= E47), Y187 (= Y183), N191 (≠ V187), R205 (= R201), W209 (≠ L205)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 79% coverage: 11:250/303 of query aligns to 5:254/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
31% identity, 78% coverage: 9:243/303 of query aligns to 4:262/502 of 6brlA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
30% identity, 86% coverage: 9:268/303 of query aligns to 104:365/564 of 3al0C
- active site: S110 (= S15), K335 (= K242)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R11), A108 (= A13), P109 (= P14), G118 (= G23), T122 (≠ A27), E142 (= E47), Y276 (= Y183), R294 (= R201), G295 (= G202), D297 (= D204), H298 (≠ L205), L324 (= L231), I325 (≠ A232), L333 (= L240)
- binding : T144 (≠ V49), D145 (= D50), R148 (= R53), Y208 (≠ C105), P213 (vs. gap), K252 (≠ L158), M255 (≠ V161), I266 (≠ V173), K269 (≠ R176), S270 (≠ A177), Y276 (= Y183), D297 (= D204), H298 (≠ L205), L299 (= L206), S300 (≠ D207), N301 (≠ S208), K304 (≠ R211), R330 (≠ G237), P332 (≠ K239), G363 (= G266), W364 (≠ Q267), R365 (= R268)
Sites not aligning to the query:
- binding : 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
31% identity, 90% coverage: 6:278/303 of query aligns to 2:280/488 of 8vc5A
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
33% identity, 72% coverage: 11:228/303 of query aligns to 14:228/455 of 3aiiA
Sites not aligning to the query:
2re8A Glutaminyl-tRNA synthetase mutant c229r with bound analog 5'-o-[n-(l- glutamyl)-sulfamoyl]adenosine (see paper)
22% identity, 70% coverage: 11:223/303 of query aligns to 23:244/529 of 2re8A
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: P25 (≠ A13), P26 (= P14), E27 (≠ S15), G35 (= G23), H36 (≠ S24), D59 (≠ E47), Y204 (= Y183), H208 (≠ V187), R222 (= R201), T223 (≠ G202)
- binding : E27 (≠ S15), T61 (≠ V49), N62 (≠ D50), L117 (≠ C105), P119 (≠ R107), R123 (≠ A111), R126 (≠ H114), T128 (vs. gap), L129 (vs. gap), G161 (= G136), P174 (≠ R149), F175 (≠ E150), I176 (≠ V151), V182 (≠ L157), R185 (= R160), M203 (≠ A182), Y204 (= Y183), F226 (≠ L205), D228 (= D207)
Sites not aligning to the query:
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: 253, 254, 263
- binding : 6, 306, 309, 310, 311, 313, 314, 316, 319, 322, 329, 334, 362, 363, 392, 394, 395, 403, 405, 406, 435, 499, 501, 502, 527
Query Sequence
>Dsui_1040 FitnessBrowser__PS:Dsui_1040
MTRSPSAYRGRFAPSPSGPLHFGSLVAALGSCLEARCRQGEWLVRMEDVDGPRTVPGAAD
AILRSLEAYGFVWDGPVLWQSQRHEAYAAALARLQAAGLAYPCACSRKEIAEGHGGRSID
GAPRYAGTCRSGLQPGQSPRAWRLRLPDREVSFEDGLLGRVGHNLERDVGDIVLLRADGQ
YAYQLAVVVDDAFQGVTHVVRGADLLDSTPRQIWLQQCLGVPTPAYVHLPLATNARGEKL
SKQTRALALDDDRPVPALVDALEFLGQRPPPALRAASRDEVWAWAVAHWNLALVPRCRAV
SLE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory