SitesBLAST
Comparing Dsui_1048 FitnessBrowser__PS:Dsui_1048 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9C5 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Escherichia coli (strain K12) (see 3 papers)
67% identity, 100% coverage: 3:470/470 of query aligns to 2:469/469 of P0A9C5
- Y398 (= Y399) modified: O-AMP-tyrosine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P0A1P6 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
66% identity, 100% coverage: 3:470/470 of query aligns to 2:469/469 of P0A1P6
1fpyA Crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin (see paper)
66% identity, 100% coverage: 3:470/470 of query aligns to 1:468/468 of 1fpyA
- binding adenosine-5'-diphosphate: G127 (= G129), E129 (= E131), E207 (= E209), T223 (= T225), F225 (= F227), H271 (= H273), S273 (= S275), R355 (= R357), E357 (= E359)
- binding manganese (ii) ion: E129 (= E131), E131 (= E133), E212 (= E214), E220 (= E222), H269 (= H271), E357 (= E359)
- binding phosphinothricin: E131 (= E133), E212 (= E214), G265 (= G267), H269 (= H271), R321 (= R323), E327 (= E329), R359 (= R361)
1f1hA Crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions (see paper)
66% identity, 100% coverage: 3:470/470 of query aligns to 1:468/468 of 1f1hA
- binding adenosine-5'-diphosphate: E129 (= E131), E207 (= E209), H210 (= H212), E220 (= E222), T223 (= T225), F225 (= F227), H271 (= H273), S273 (= S275), R355 (= R357)
- binding manganese (ii) ion: E129 (= E131), E131 (= E133), E212 (= E214), E220 (= E222), H269 (= H271), E357 (= E359)
2lgsA Feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine (see paper)
63% identity, 100% coverage: 3:470/470 of query aligns to 1:445/445 of 2lgsA
- binding glutamic acid: E125 (= E133), N258 (= N266), G259 (= G267), G261 (= G269), H263 (= H271), R315 (= R323), R349 (= R361)
- binding manganese (ii) ion: E123 (= E131), E125 (= E133), E206 (= E214), E214 (= E222), H263 (= H271), E347 (= E359)
1lgrA Interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium (see paper)
63% identity, 100% coverage: 3:470/470 of query aligns to 1:445/445 of 1lgrA
- binding adenosine monophosphate: E201 (= E209), T217 (= T225), F219 (= F227), H265 (= H273), S267 (= S275), R345 (= R357)
- binding manganese (ii) ion: E123 (= E131), E125 (= E133), E206 (= E214), E214 (= E222), H263 (= H271), E347 (= E359)
P77961 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Synechocystis sp. (strain PCC 6803 / Kazusa)
54% identity, 100% coverage: 3:470/470 of query aligns to 4:473/473 of P77961
- E134 (= E133) binding
- E215 (= E214) binding
- E223 (= E222) binding
- E361 (= E359) binding
3ng0A Crystal structure of glutamine synthetase from synechocystis sp. Pcc 6803
54% identity, 100% coverage: 3:470/470 of query aligns to 2:465/465 of 3ng0A
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E213 (= E214), E221 (= E222), H270 (= H271), R340 (= R341), E359 (= E359), R361 (= R361)
- binding phosphoaminophosphonic acid-adenylate ester: Y126 (≠ F127), E130 (= E131), K209 (≠ V210), I224 (≠ T225), F226 (= F227), H272 (= H273), S274 (= S275), R340 (= R341), R345 (= R346), R357 (= R357)
- binding manganese (ii) ion: E130 (= E131), E132 (= E133), E213 (= E214), E221 (= E222), H270 (= H271), E359 (= E359), R361 (= R361)
A0R079 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
53% identity, 99% coverage: 3:468/470 of query aligns to 5:476/478 of A0R079
- K14 (= K12) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1htoA Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis (see paper)
52% identity, 99% coverage: 3:468/470 of query aligns to 4:475/477 of 1htoA
- active site: D53 (= D52), E132 (= E131), E134 (= E133), E218 (= E214), E226 (= E222), H275 (= H271), R346 (= R341), E365 (= E359), R367 (= R361)
- binding adenosine monophosphate: Y128 (≠ F127), G130 (= G129), E132 (= E131), F231 (= F227), H277 (= H273), S279 (= S275), R363 (= R357)
- binding manganese (ii) ion: E132 (= E131), H275 (= H271), E365 (= E359)
4acfA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.
52% identity, 99% coverage: 3:468/470 of query aligns to 2:473/475 of 4acfA
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), H273 (= H271), R344 (= R341), E363 (= E359), R365 (= R361)
- binding {4-[6-bromo-3-(butylamino)imidazo[1,2-a]pyridin-2-yl]phenoxy}acetic acid: Y126 (≠ F127), F229 (= F227), H275 (= H273), Q276 (= Q274), W279 (= W277), N356 (≠ T353), K358 (= K354), R361 (= R357)
- binding magnesium ion: E130 (= E131), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), E224 (= E222), H273 (= H271), E363 (= E359)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), G269 (= G267), H273 (= H271), R326 (= R323), E332 (= E329), R344 (= R341), R365 (= R361)
3zxvA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate (see paper)
52% identity, 99% coverage: 3:468/470 of query aligns to 2:473/475 of 3zxvA
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), H273 (= H271), R344 (= R341), E363 (= E359), R365 (= R361)
- binding magnesium ion: E130 (= E131), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), E224 (= E222), H273 (= H271), E363 (= E359)
- binding 4-(2-tert-butyl-4-(6-methoxynaphthalen-2-yl)-3h-imidazol-4-yl)pyridin-2-amine: Y126 (≠ F127), G128 (= G129), F229 (= F227), H275 (= H273), S277 (= S275), K358 (= K354), R361 (= R357)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), G269 (= G267), H273 (= H271), R326 (= R323), E332 (= E329), R344 (= R341), R365 (= R361)
3zxrA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate. (see paper)
52% identity, 99% coverage: 3:468/470 of query aligns to 2:473/475 of 3zxrA
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), H273 (= H271), R344 (= R341), E363 (= E359), R365 (= R361)
- binding 3-(2-tert-butyl-5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline: G128 (= G129), F229 (= F227), H275 (= H273), S277 (= S275), R361 (= R357)
- binding magnesium ion: E130 (= E131), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), E224 (= E222), H273 (= H271), E363 (= E359)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), H273 (= H271), R326 (= R323), E332 (= E329), R344 (= R341), R365 (= R361)
2bvcA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic (see paper)
52% identity, 99% coverage: 3:468/470 of query aligns to 2:473/475 of 2bvcA
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), H273 (= H271), R344 (= R341), E363 (= E359), R365 (= R361)
- binding adenosine-5'-diphosphate: E130 (= E131), E211 (= E209), K212 (≠ V210), N226 (≠ G224), F229 (= F227), H275 (= H273), S277 (= S275), R344 (= R341), R349 (= R346), R361 (= R357), E363 (= E359)
- binding magnesium ion: E130 (= E131), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), E224 (= E222), H273 (= H271), E363 (= E359)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E222), G269 (= G267), H273 (= H271), R326 (= R323), E332 (= E329), R344 (= R341), R365 (= R361)
P9WN39 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 5 papers)
52% identity, 99% coverage: 3:468/470 of query aligns to 5:476/478 of P9WN39
- E133 (= E131) binding
- E135 (= E133) binding
- E219 (= E214) binding
- E227 (= E222) binding
- H276 (= H271) binding
- E366 (= E359) binding
- Y406 (= Y399) modified: O-AMP-tyrosine; mutation to F: Unable to be adenylylated.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2whiA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate. (see paper)
52% identity, 99% coverage: 3:468/470 of query aligns to 3:474/476 of 2whiA
- active site: D52 (= D52), E131 (= E131), E133 (= E133), E217 (= E214), E225 (= E222), H274 (= H271), R345 (= R341), E364 (= E359), R366 (= R361)
- binding 1-(3,4-dichlorobenzyl)-3,7-dimethyl-8-morpholin-4-yl-3,7-dihydro-1H-purine-2,6-dione: Y127 (≠ F127), G129 (= G129), F230 (= F227), H276 (= H273), S278 (= S275), W280 (= W277), K359 (= K354), R362 (= R357)
- binding magnesium ion: E131 (= E131), E131 (= E131), E133 (= E133), E217 (= E214), E225 (= E222), E225 (= E222), H274 (= H271), E364 (= E359)
- binding l-methionine-s-sulfoximine phosphate: E131 (= E131), E133 (= E133), E217 (= E214), E225 (= E222), G270 (= G267), H274 (= H271), R327 (= R323), E333 (= E329), R345 (= R341), R366 (= R361)
- binding phosphate ion: E131 (= E131), R350 (= R346), E364 (= E359)
4xycA Nanomolar inhibitors of mycobacterium tuberculosis glutamine synthetase 1: synthesis, biological evaluation and x-ray crystallographic studies (see paper)
51% identity, 99% coverage: 3:468/470 of query aligns to 2:464/466 of 4xycA
- active site: D51 (= D52), E121 (= E131), E123 (= E133), E207 (= E214), E215 (= E222), H264 (= H271), R335 (= R341), E354 (= E359), R356 (= R361)
- binding 9-phenyl-4H-imidazo[1,2-a]indeno[1,2-e]pyrazin-4-one: Y117 (≠ F127), F220 (= F227), H266 (= H273), S268 (= S275), W270 (= W277), K349 (= K354), A350 (= A355), R352 (= R357)
5zlpJ Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
47% identity, 99% coverage: 5:470/470 of query aligns to 10:478/478 of 5zlpJ
- binding adenosine-5'-diphosphate: Y132 (≠ F127), E136 (= E131), F215 (≠ E209), F232 (= F227), H278 (= H273), S280 (= S275), R351 (= R346), R362 (= R357)
- binding magnesium ion: E138 (= E133), E220 (= E214), E227 (= E222)
- binding phosphinothricin: E138 (= E133), E220 (= E214), G272 (= G267), H276 (= H271), E334 (= E329), R346 (= R341), R366 (= R361)
5zlpL Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
47% identity, 99% coverage: 5:470/470 of query aligns to 8:476/476 of 5zlpL
- binding adenosine-5'-diphosphate: G132 (= G129), E134 (= E131), F213 (≠ E209), F230 (= F227), H276 (= H273), S278 (= S275), R349 (= R346), R360 (= R357)
- binding magnesium ion: E136 (= E133), E218 (= E214), E225 (= E222)
- binding (2s)-2-amino-4-[methyl(phosphonooxy)phosphoryl]butanoic acid: E136 (= E133), E218 (= E214), G270 (= G267), H274 (= H271), E332 (= E329), R344 (= R341), R364 (= R361)
5zlpA Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
47% identity, 99% coverage: 5:470/470 of query aligns to 8:476/476 of 5zlpA
Query Sequence
>Dsui_1048 FitnessBrowser__PS:Dsui_1048
MATPQDIMKMVKENDVKFVDFRFTDTRGKEQHVGVPVSAFDEDKFESGHAFDGSSIAGWK
GIQASDMLLMPDPNTAYIDPFFDETTLILTCDVVEPADGKGYDRDPRSIAKRAEAYLKSS
GIGDTAFFGPEPEFFIFDSVEWKTDMSGTYVKIFSEEAAWSTAEKFDGGNAGHRPMVKGG
YFPVPPVDSFNDMRAQMCLLLEACGVPVEVHHHEVATAGQNEIGTVFNTLVRRADQTQIL
KYIVHNVAHQYGKTATFMPKPIVGDNGSGMHVHQSIWKDGQNLFAGNGYAGLSETALYYI
GGIIKHAKALNAITNPGTNSYKRLVPHYEAPVKLAYSAKNRSASIRVPFVQSTKARRIET
RFPDPIANPYLCFAALLMAGLDGIQNKIHPGDAADKNLYDLPPEEDAKIPTVCASLDEAL
ANLDKDREFLTRGGVFSNDWIDSFIDLKMEEVNKLRMTTHPVEFDLYYSC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory