SitesBLAST
Comparing Dsui_1099 FitnessBrowser__PS:Dsui_1099 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8Z9S7 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Yersinia pestis
55% identity, 100% coverage: 1:451/452 of query aligns to 6:456/456 of Q8Z9S7
- R333 (= R328) binding
- K351 (= K346) binding
- Y366 (= Y361) binding
- N377 (= N372) binding
P43889 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
53% identity, 100% coverage: 1:451/452 of query aligns to 6:456/456 of P43889
- LAAG 11:14 (= LAAG 6:9) binding
- K25 (= K20) mutation to A: No pyrophosphorylase activity.
- Q76 (= Q71) binding ; mutation to A: No pyrophosphorylase activity.
- GT 81:82 (= GT 76:77) binding
- Y103 (= Y98) mutation to A: Reduces the pyrophosphorylase activity.
- YGD 103:105 (= YGD 98:100) binding
- D105 (= D100) mutation to A: No pyrophosphorylase activity.
- G140 (= G134) binding
- E154 (= E149) binding
- N169 (= N164) binding
- V223 (= V218) mutation to A: Reduces slightly the pyrophosphorylase activity.
- E224 (≠ A219) mutation to A: Reduces the pyrophosphorylase activity.
2v0jA Characterization of substrate binding and catalysis of the potential antibacterial target n-acetylglucosamine-1-phosphate uridyltransferase (glmu) (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/449 of 2v0jA
4kqlA Hin glmu bound to wg578 (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 4kqlA
- active site: R15 (= R13)
- binding N-(4-{[3-(2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-5-methoxybenzoyl]amino}phenyl)pyridine-2-carboxamide: A9 (= A7), A10 (= A8), Q73 (= Q71), Q76 (= Q74), G78 (= G76), T79 (= T77), Y100 (= Y98), D102 (= D100), Y136 (= Y133), T167 (= T165), V220 (= V218), G222 (= G220)
4kpzA Hin glmu bound to a small molecule fragment (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 4kpzA
- active site: R15 (= R13)
- binding 1-(3-nitrophenyl)dihydropyrimidine-2,4(1H,3H)-dione: L8 (= L6), A9 (= A7), A10 (= A8), G11 (= G9), V23 (= V21), Q73 (= Q71), Q76 (= Q74), G78 (= G76), D102 (= D100)
4kpxA Hin glmu bound to wg766 (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 4kpxA
4knxA Hin glmu bound to wg176 (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 4knxA
- active site: R15 (= R13)
- binding [(4-{[4-(benzoylamino)phenyl]amino}-6-methoxyquinazolin-7-yl)oxy]acetic acid: L8 (= L6), A10 (= A8), G11 (= G9), Q73 (= Q71), Q76 (= Q74), T79 (= T77), Y100 (= Y98), D102 (= D100), Y136 (= Y133), T167 (= T165), V220 (= V218), G222 (= G220)
4knrA Hin glmu bound to wg188 (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 4knrA
4e1kA Glmu in complex with a quinazoline compound (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 4e1kA
2w0wA Crystal structure of glmu from haemophilus influenzae in complex with quinazoline inhibitor 2
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 2w0wA
- active site: R15 (= R13)
- binding n-{6-(cyclopropylmethoxy)-7-methoxy-2-[6-(2-methylpropyl)-5-oxo-3,4,5,6-tetrahydro-2,6-naphthyridin-2(1h)-yl]quinazolin-4-yl}-2,2,2-trifluoroethanesulfonamide: L8 (= L6), G11 (= G9), Q73 (= Q71), T79 (= T77), Y100 (= Y98), D102 (= D100), Y136 (= Y133), N166 (= N164), T167 (= T165), G168 (= G166), V220 (= V218), G222 (= G220), P449 (= P447)
Sites not aligning to the query:
2w0vA Crystal structure of glmu from haemophilus influenzae in complex with quinazoline inhibitor 1
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 2w0vA
- active site: R15 (= R13)
- binding 6-(cycloprop-2-en-1-ylmethoxy)-2-[6-(cyclopropylmethyl)-5-oxo-3,4,5,6-tetrahydro-2,6-naphthyridin-2(1h)-yl]-7-methoxyquinazolin-4(3h)-one: L8 (= L6), G11 (= G9), Y100 (= Y98), D102 (= D100), V128 (= V125), T167 (= T165), V220 (= V218), G222 (= G220)
Sites not aligning to the query:
2vd4A Structure of small-molecule inhibitor of glmu from haemophilus influenzae reveals an allosteric binding site (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 2vd4A
2v0lA Characterization of substrate binding and catalysis of the potential antibacterial target n-acetylglucosamine-1-phosphate uridyltransferase (glmu) (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 2v0lA
Sites not aligning to the query:
2v0kA Characterization of substrate binding and catalysis of the potential antibacterial target n-acetylglucosamine-1- phosphate uridyltransferase (glmu) (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 2v0kA
2v0iA Characterization of substrate binding and catalysis of the potential antibacterial target n-acetylglucosamine-1-phosphate uridyltransferase (glmu) (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/450 of 2v0iA
- active site: R15 (= R13)
- binding uridine-diphosphate-n-acetylglucosamine: A10 (= A8), Q73 (= Q71), Q76 (= Q74), G78 (= G76), T79 (= T77), D102 (= D100), Y136 (= Y133), G137 (= G134), E151 (= E149), N166 (= N164), T167 (= T165), Y194 (= Y192), T196 (= T194)
Sites not aligning to the query:
P0ACC7 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Escherichia coli (strain K12) (see 6 papers)
53% identity, 100% coverage: 1:451/452 of query aligns to 6:456/456 of P0ACC7
- LAAG 11:14 (= LAAG 6:9) binding
- G14 (= G9) mutation to A: 8-fold decrease in uridyltransferase activity. Creates steric conflict and decreases affinity for UTP.
- R18 (= R13) mutation to A: Dramatically impairs the uridyltransferase activity.
- K25 (= K20) mutation to A: 8-fold decrease in uridyltransferase activity.
- Q76 (= Q71) binding
- GT 81:82 (= GT 76:77) binding
- YGD 103:105 (= YGD 98:100) binding
- D105 (= D100) binding ; binding
- G140 (= G134) binding
- E154 (= E149) binding
- N169 (= N164) binding
- N227 (= N222) binding ; binding
- 230:250 (vs. 225:245, 52% identical) Linker
- 251:456 (vs. 246:451, 56% identical) N-acetyltransferase
- C296 (= C291) mutation to A: No effect.
- C307 (≠ A302) mutation to A: 1350-fold decrease in acetyltransferase activity.
- C324 (≠ A319) mutation to A: 8-fold decrease in acetyltransferase activity.
- R333 (= R328) binding
- K351 (= K346) binding
- Y366 (= Y361) binding
- N377 (= N372) binding
- A380 (= A375) binding
- C385 (= C380) mutation to A: No effect.
- S405 (= S400) binding
- A423 (= A418) binding
- R440 (= R435) binding
Sites not aligning to the query:
4fceA Crystal structure of yersinia pestis glmu in complex with alpha-d- glucosamine 1-phosphate (gp1)
54% identity, 98% coverage: 1:444/452 of query aligns to 3:441/441 of 4fceA
2oi6B E. Coli glmu- complex with udp-glcnac, coa and glcn-1-po4 (see paper)
53% identity, 99% coverage: 1:449/452 of query aligns to 4:452/452 of 2oi6B
- active site: R16 (= R13)
- binding coenzyme a: G402 (= G399), S403 (= S400), A420 (≠ G417), A421 (= A418), R438 (= R435)
- binding 2-amino-2-deoxy-1-O-phosphono-alpha-D-glucopyranose: H361 (= H358), N375 (= N372)
- binding magnesium ion: D103 (= D100), N225 (= N222)
- binding uridine-diphosphate-n-acetylglucosamine: L9 (= L6), A10 (= A7), A11 (= A8), G12 (= G9), Q74 (= Q71), Q77 (= Q74), G79 (= G76), T80 (= T77), Y101 (= Y98), D103 (= D100), Y137 (= Y133), G138 (= G134), E152 (= E149), N167 (= N164), T168 (= T165), T197 (= T194), N225 (= N222)
2oi7A E. Coli glmu- complex with udp-glcnac, desulpho-coa and glcnac-1-po4 (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/449 of 2oi7A
- active site: R15 (= R13)
- binding desulfo-coenzyme a: G401 (= G399), S402 (= S400), A419 (≠ G417), A420 (= A418), R437 (= R435)
- binding 2-acetamido-2-deoxy-1-O-phosphono-alpha-D-glucopyranose: K357 (= K355), H360 (= H358), N374 (= N372), A377 (= A375)
- binding uridine-diphosphate-n-acetylglucosamine: L8 (= L6), A10 (= A8), G11 (= G9), Q73 (= Q71), Q76 (= Q74), G78 (= G76), T79 (= T77), Y100 (= Y98), D102 (= D100), Y136 (= Y133), G137 (= G134), E151 (= E149), N166 (= N164), T196 (= T194)
2oi5A E. Coli glmu- complex with udp-glcnac and acetyl-coa (see paper)
53% identity, 99% coverage: 1:447/452 of query aligns to 3:449/449 of 2oi5A
- active site: R15 (= R13)
- binding acetyl coenzyme *a: G376 (= G374), F399 (= F397), G401 (= G399), S402 (= S400), A419 (≠ G417), A420 (= A418), R437 (= R435)
- binding uridine-diphosphate-n-acetylglucosamine: L8 (= L6), A10 (= A8), G11 (= G9), Q73 (= Q71), Q76 (= Q74), G78 (= G76), T79 (= T77), Y100 (= Y98), D102 (= D100), Y136 (= Y133), G137 (= G134), E151 (= E149), N166 (= N164), Y194 (= Y192), T196 (= T194)
Query Sequence
>Dsui_1099 FitnessBrowser__PS:Dsui_1099
MNIVILAAGQGKRMHSHLPKVLHPIAGKALAAHVLDTARHLGQSRICLVVGHGGEVVRSA
LAAADVACAVQEPQLGTGHAVMQALPLLDGEGMTLVLYGDVPLIQATTLQRLVQAAGDGL
AVLTVDLENPKGYGRIIRDSAGRVQRIVEEKDATPAERLVRETNTGIMALPTARLKDWLS
RLSNDNAQGEYYLTDVVALAVADGVPVHTAQPEGEWEVAGVNSKVQLAELERVYQLRLAH
GLLEQGVRLADPARLDVRGQLRCGRDVAIDVGCVFEGEVVLEEAVDIGPYCVLKNVTVKA
GARIAAFSHLEGAVVGPDAIVGPYARLRPGTELGAEAHVGNFVELKNSILGPGSKANHLA
YVGDATVGQRVNIGAGTITCNYDGANKHRTVIEDDAFIGSDSQLVAPVTVGRGATLGAGT
TLTKDAPADSLTVSRARQVSLAGWKRPEKVKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory