SitesBLAST
Comparing Dsui_1101 FitnessBrowser__PS:Dsui_1101 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
57% identity, 100% coverage: 2:608/608 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W73), N98 (= N97), G99 (= G98), Y248 (≠ F247), E481 (= E481), K485 (= K485), E488 (= E488), H504 (= H504), K603 (= K603)
- binding fructose -6-phosphate: G301 (= G300), T302 (= T301), S303 (= S302), S347 (= S346), Q348 (= Q347), S349 (= S348), T352 (= T351), S401 (= S400), K485 (= K485), E488 (= E488)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
57% identity, 100% coverage: 2:608/608 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W73), N98 (= N97), G99 (= G98), Y248 (≠ F247), E481 (= E481), K485 (= K485), E488 (= E488), H504 (= H504), K603 (= K603)
- binding glucose-6-phosphate: T302 (= T301), S303 (= S302), S347 (= S346), Q348 (= Q347), S349 (= S348), T352 (= T351), S401 (= S400), K485 (= K485), E488 (= E488)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
56% identity, 100% coverage: 2:608/608 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W73), N98 (= N97), G99 (= G98), Y248 (≠ F247), E481 (= E481), K485 (= K485), E488 (= E488), H504 (= H504), K603 (= K603)
- binding glucose-6-phosphate: T302 (= T301), S347 (= S346), Q348 (= Q347), S349 (= S348), T352 (= T351), V399 (= V398), S401 (= S400), E488 (= E488)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R72), W74 (= W73), T76 (= T75), H86 (= H85), N98 (= N97), G99 (= G98), D123 (= D122)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
59% identity, 60% coverage: 245:608/608 of query aligns to 4:366/366 of 1morA
- active site: E239 (= E481), K243 (= K485), E246 (= E488), H262 (= H504), K361 (= K603)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T301), S105 (= S346), Q106 (= Q347), S107 (= S348), T110 (= T351), V157 (= V398), A360 (= A602), K361 (= K603)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
59% identity, 60% coverage: 245:608/608 of query aligns to 4:366/366 of 1moqA
- active site: E239 (= E481), K243 (= K485), E246 (= E488), H262 (= H504), K361 (= K603)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T301), S61 (= S302), S105 (= S346), Q106 (= Q347), S107 (= S348), T110 (= T351), V157 (= V398), A360 (= A602), K361 (= K603)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
59% identity, 60% coverage: 245:608/608 of query aligns to 5:367/367 of 1mosA
- active site: E240 (= E481), K244 (= K485), E247 (= E488), H263 (= H504), K362 (= K603)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T301), S62 (= S302), S106 (= S346), Q107 (= Q347), S108 (= S348), T111 (= T351), K244 (= K485), E247 (= E488)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
58% identity, 58% coverage: 245:599/608 of query aligns to 4:357/357 of 7dnrA
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
38% identity, 100% coverage: 2:608/608 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (vs. gap), R32 (= R27), W95 (= W73), N122 (= N97), G123 (= G98), E536 (= E481), K540 (= K485), E543 (= E488), H559 (= H504), K658 (= K603)
- binding glucose-6-phosphate: T358 (= T301), S359 (= S302), S403 (= S346), Q404 (= Q347), S405 (= S348), T408 (= T351), S456 (= S400), K540 (= K485), E543 (= E488)
- binding glutamic acid: C1 (= C2), R94 (= R72), W95 (= W73), T97 (= T75), G123 (= G98), D147 (= D122)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
38% identity, 100% coverage: 2:608/608 of query aligns to 1:660/660 of 6svmA
- active site: L7 (vs. gap), R32 (= R27), W95 (= W73), N122 (= N97), G123 (= G98), E533 (= E481), K537 (= K485), E540 (= E488), H556 (= H504), K655 (= K603)
- binding glucose-6-phosphate: C353 (= C299), T355 (= T301), S356 (= S302), S400 (= S346), Q401 (= Q347), S402 (= S348), T405 (= T351), S453 (= S400), K537 (= K485), E540 (= E488)
- binding glutamic acid: C1 (= C2), R94 (= R72), W95 (= W73), T97 (= T75), H107 (= H85), G123 (= G98), D147 (= D122)
- binding magnesium ion: S434 (≠ V381), R435 (= R382), T437 (≠ C384)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ S236), R322 (≠ V269), G334 (= G281), G424 (≠ A371), T426 (≠ C373), S434 (≠ V381), T437 (≠ C384), C439 (≠ L386), G440 (≠ R387), V441 (≠ F388), H442 (≠ I389)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
37% identity, 100% coverage: 1:608/608 of query aligns to 1:699/699 of Q06210
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
38% identity, 99% coverage: 2:601/608 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (vs. gap), R32 (= R27), W95 (= W73), N122 (= N97), G123 (= G98), E532 (= E481), K536 (= K485), E539 (= E488), H555 (= H504)
- binding glucose-6-phosphate: G353 (= G300), T354 (= T301), S355 (= S302), S399 (= S346), Q400 (= Q347), S401 (= S348), T404 (= T351), S452 (= S400), E539 (= E488)
- binding magnesium ion: S433 (≠ V381), R434 (= R382), T436 (≠ C384)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ S236), R321 (≠ V269), G333 (= G281), G423 (≠ A371), T425 (≠ C373), S433 (≠ V381), T436 (≠ C384), C438 (≠ L386), G439 (≠ R387), V440 (≠ F388), H441 (≠ I389)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
37% identity, 73% coverage: 167:608/608 of query aligns to 274:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
42% identity, 60% coverage: 245:608/608 of query aligns to 3:365/365 of 2zj4A
- active site: E238 (= E481), K242 (= K485), E245 (= E488), H261 (= H504), K360 (= K603)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T301), S61 (= S302), S105 (= S346), Q106 (= Q347), S107 (= S348), T110 (= T351), V156 (= V398), A157 (= A399), K242 (= K485), E245 (= E488)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
42% identity, 60% coverage: 245:608/608 of query aligns to 3:365/365 of 2zj3A
- active site: E238 (= E481), K242 (= K485), E245 (= E488), H261 (= H504), K360 (= K603)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T301), S61 (= S302), S105 (= S346), Q106 (= Q347), S107 (= S348), T110 (= T351), V156 (= V398), A359 (= A602), K360 (= K603)
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
40% identity, 58% coverage: 245:596/608 of query aligns to 2:352/352 of 2v4mA
- active site: E237 (= E481), K241 (= K485), E244 (= E488), H260 (= H504)
- binding fructose -6-phosphate: T59 (= T301), S60 (= S302), S104 (= S346), Q105 (= Q347), S106 (= S348), T109 (= T351), A156 (= A399), S157 (= S400), K241 (= K485), E244 (= E488)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
53% identity, 39% coverage: 2:237/608 of query aligns to 1:238/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W73), N98 (= N97), G99 (= G98)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R72), W74 (= W73), T76 (= T75), H86 (= H85), N98 (= N97), G99 (= G98), D123 (= D122)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
53% identity, 39% coverage: 2:237/608 of query aligns to 1:238/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W73), N98 (= N97), G99 (= G98)
- binding glutamic acid: C1 (= C2), R73 (= R72), W74 (= W73), T76 (= T75), H86 (= H85), N98 (= N97), G99 (= G98), D123 (= D122)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
41% identity, 58% coverage: 247:596/608 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E481), K240 (= K485), E243 (= E488), H259 (= H504)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C299), T57 (= T301), S58 (= S302), S102 (= S346), Q103 (= Q347), S104 (= S348), T107 (= T351), E243 (= E488)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ V269), G36 (= G281), G126 (≠ A371), V128 (≠ C373), S136 (≠ V381), T139 (≠ C384), C141 (≠ L386), G142 (≠ R387), V143 (≠ F388), H144 (≠ I389)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
39% identity, 58% coverage: 247:596/608 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E481), K240 (= K485), E243 (= E488)
- binding fructose -6-phosphate: C55 (= C299), T57 (= T301), S102 (= S346), Q103 (= Q347), S104 (= S348), T107 (= T351), A154 (= A399), S155 (= S400), K240 (= K485)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ V269), G36 (= G281), G126 (≠ A371), V128 (≠ C373), S136 (≠ V381), T139 (≠ C384), C141 (≠ L386), G142 (≠ R387), V143 (≠ F388), H144 (≠ I389)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
39% identity, 58% coverage: 245:596/608 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E481), K241 (= K485), E244 (= E488)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C299), T58 (= T301), S103 (= S346), Q104 (= Q347), S105 (= S348), T108 (= T351), A155 (= A399), E244 (= E488)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (≠ V269), G37 (= G281), G127 (≠ A371), V129 (≠ C373), S137 (≠ V381), T140 (≠ C384), C142 (≠ L386), G143 (≠ R387), V144 (≠ F388), H145 (≠ I389)
Query Sequence
>Dsui_1101 FitnessBrowser__PS:Dsui_1101
MCGIVAAAARNNIVPVLLEGLRKLEYRGYDSAGLAILNGGLQRLRSVGRVAELAAQADST
GATSETGIAHTRWATHGVPSERNAHPHISEGLAVVHNGIIENYESLRAELSALGYSFSSE
TDTETIAHLIHHTLKSEPDLFRAVCRTVQRLQGAYAIAVVKEDEPGRVIVAREGSPLLLG
VGEQGNYAASDASALLQVTRRIVYLENGDVAELRPESWRVARADGAPVERPVALSSLSAD
AVELGRFRHYMQKEIFEQPDALANTLEMVGGAKSLQAGLFGAEAETLLGGATSVLILACG
TSSHAGMAARYWLEAVAGIPCTVETASEYRYRESVPQADQLVIAISQSGETADTLAALRH
AKALGHHRTLALCNVPESAIVRECALRFITRAGPEIGVASTKAFTTQLAALFLLTLVLAK
LKGRLSDTEEAIQLQALRHLPAAIGRALELEPQIKAWAERFAMKQHALFLGRGIHYPIAL
EGALKLKEISYIHAEAYPAGELKHGPLALVDKDMPVIAVAPNDVLLEKLKSNLQEVKARG
GELYVFADADSEIAESEGVHILRLPEHYGRLSPILHVIPLQLLSYHAALVKGTDVDKPRN
LAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory