SitesBLAST
Comparing Dsui_1114 FitnessBrowser__PS:Dsui_1114 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
28% identity, 99% coverage: 3:407/410 of query aligns to 7:431/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (≠ G205), E216 (= E206), P217 (≠ A207), S237 (≠ D231), F238 (≠ L232), G239 (= G233), M240 (= M234), T241 (vs. gap), D305 (= D290), R329 (= R314), N340 (≠ F325)
- binding adenosine monophosphate: A215 (≠ G205), E216 (= E206), P217 (≠ A207), S237 (≠ D231), F238 (≠ L232), G239 (= G233), M240 (= M234), T241 (vs. gap), D305 (= D290), R329 (= R314), N340 (≠ F325)
- binding coenzyme a: S136 (≠ T128), A164 (≠ I156), G165 (= G157), N166 (≠ Q158), S167 (≠ T159), I185 (≠ T177), Y188 (≠ F180), K337 (= K322), T408 (≠ R385)
- binding zinc ion: C252 (≠ S239), H259 (≠ T246), C314 (≠ S299), C316 (= C301)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
28% identity, 99% coverage: 3:407/410 of query aligns to 7:433/435 of 4r1mA
- binding adenosine monophosphate: A215 (≠ G205), E216 (= E206), P217 (≠ A207), N236 (≠ A230), S237 (≠ D231), F238 (≠ L232), G239 (= G233), M240 (= M234), T241 (vs. gap), D305 (= D290), R329 (= R314), I335 (≠ K320), N340 (≠ F325)
- binding zinc ion: C252 (≠ S239), H259 (≠ T246), C314 (≠ S299), C316 (= C301)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
31% identity, 87% coverage: 5:362/410 of query aligns to 7:374/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (= F129), F140 (≠ T134), A213 (≠ G205), E214 (= E206), P215 (≠ A207), I235 (≠ C226), G237 (≠ A228), L238 (≠ T229), S239 (≠ A230), P244 (vs. gap), D304 (= D290), R325 (= R314), I331 (≠ K320), N336 (≠ F325)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
31% identity, 87% coverage: 5:362/410 of query aligns to 7:374/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (= F129), F140 (≠ T134), G212 (≠ S204), A213 (≠ G205), E214 (= E206), P215 (≠ A207), I235 (≠ C226), G237 (≠ A228), L238 (≠ T229), S239 (≠ A230), P244 (vs. gap), D304 (= D290), R325 (= R314), I331 (≠ K320), N336 (≠ F325)
- binding magnesium ion: S204 (≠ T196), V228 (vs. gap)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
33% identity, 80% coverage: 5:331/410 of query aligns to 5:340/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (= K63), S90 (= S93), S91 (≠ P94), G92 (= G95), T93 (≠ P96), T94 (≠ I97), F138 (≠ T134), A211 (≠ G205), E212 (= E206), P213 (≠ A207), D232 (≠ Q225), I233 (≠ C226), Y234 (= Y227), G235 (≠ A228), L236 (≠ T229), S237 (≠ A230), D302 (= D290), I320 (≠ W311), R323 (= R314)
- binding magnesium ion: V200 (vs. gap), S202 (≠ T196), L204 (= L198), M226 (vs. gap), G227 (= G220)
Sites not aligning to the query:
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
33% identity, 80% coverage: 5:331/410 of query aligns to 5:338/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (≠ F129), F136 (≠ T134), G138 (≠ A136), G208 (≠ S204), A209 (≠ G205), E210 (= E206), P211 (≠ A207), I231 (≠ C226), Y232 (= Y227), G233 (≠ A228), L234 (≠ T229), S235 (≠ A230), P240 (vs. gap), D300 (= D290), R321 (= R314)
- binding magnesium ion: V198 (vs. gap), S200 (≠ T196)
Sites not aligning to the query:
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
26% identity, 99% coverage: 3:409/410 of query aligns to 25:467/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (= S204), G242 (= G205), E243 (= E206), P244 (vs. gap), G267 (≠ Y227), S268 (≠ A228), M269 (≠ T229), A270 (= A230), D335 (= D290), I357 (≠ W311), N371 (≠ F325)
- binding adenosine monophosphate: G242 (= G205), E243 (= E206), P244 (vs. gap), C266 (= C226), G267 (≠ Y227), S268 (≠ A228), A270 (= A230), E271 (≠ D231), D335 (= D290), N371 (≠ F325)
- binding coenzyme a: Y166 (≠ T134), A188 (≠ I156), G189 (= G157), P191 (≠ T159), S194 (≠ Q162), Y210 (≠ V175), G211 (= G176), T212 (= T177), Y215 (≠ F180), H218 (≠ I183), R368 (≠ K322), G369 (= G323), M401 (≠ Q354), V439 (≠ L384), R440 (= R385)
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
26% identity, 96% coverage: 3:396/410 of query aligns to 25:447/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ T134), S237 (= S204), G263 (≠ Y227), S264 (≠ A228), M265 (≠ T229), A266 (= A230), F271 (vs. gap)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ T134), G164 (≠ A136), S237 (= S204), G238 (= G205), E239 (= E206), P240 (vs. gap), C262 (= C226), G263 (≠ Y227), S264 (≠ A228), A266 (= A230), F271 (vs. gap), D331 (= D290), I353 (≠ W311), R356 (= R314)
Sites not aligning to the query:
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
26% identity, 96% coverage: 3:396/410 of query aligns to 25:447/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ T134), G164 (≠ A136), S237 (= S204), G238 (= G205), E239 (= E206), P240 (vs. gap), C262 (= C226), G263 (≠ Y227), S264 (≠ A228), A266 (= A230), F271 (vs. gap), D331 (= D290), I353 (≠ W311), R356 (= R314)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ T134), G164 (≠ A136), S237 (= S204), G263 (≠ Y227), S264 (≠ A228), A266 (= A230), F271 (vs. gap)
Sites not aligning to the query:
Query Sequence
>Dsui_1114 FitnessBrowser__PS:Dsui_1114
MKYYDSLETRDPEERERSLMERLPRQVAHAKLHSPYFARLLAEVNPNDIHNRAALARLPV
TRKSDLVHLQREQAPFGGINATPLSGLSRVYASPGPIYDPEGRGQDWWRFARALHGAGFR
AGELIHNTFSYHFTPAGFMLEGAAHKLGCPVFPAGIGQTEMQVQAINDLKPAAYVGTPSF
LKIILEKADELKADATSLTKALVSGEALPPSLRQALNARGITVRQCYATADLGMIAYESE
AQQGLTLDEDVLMEIVRPGTGDPVADGEVGEVLITTFNLDYPLLRFATGDLSAVLPGISP
CGRTNVRIKGWLGRADQTTKVKGMFVHPHQVAAVVKRHPEIGKARLVVDNALGQDRMVLH
CESGRGDDVLGDAVVASIRDVTKLRGEVRFVSPGDLPNDGKVIEDIRTYE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory