Comparing Dsui_1204 FitnessBrowser__PS:Dsui_1204 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
68% identity, 98% coverage: 1:126/128 of query aligns to 1:126/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
68% identity, 98% coverage: 1:126/128 of query aligns to 1:126/128 of 1fa5A
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
68% identity, 98% coverage: 1:126/128 of query aligns to 1:126/135 of P0AC81
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
62% identity, 98% coverage: 1:126/128 of query aligns to 1:126/128 of 4mttA
6bnnA Crystal structure of v278e-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 (see paper)
53% identity, 98% coverage: 2:126/128 of query aligns to 16:140/282 of 6bnnA
Sites not aligning to the query:
5d7zA Crystal structure of glyoxalase i from zea mays (see paper)
53% identity, 98% coverage: 2:126/128 of query aligns to 10:134/281 of 5d7zA
Sites not aligning to the query:
Q948T6 Lactoylglutathione lyase; Aldoketomutase; Allergen Glb33; Glyoxalase I; Glx I; Glyoxylase I 11; OsGLYI-11; OsGLYI11; Ketone-aldehyde mutase; Methylglyoxalase; PP33; S-D-lactoylglutathione methylglyoxal lyase; Allergen Ory s Glyoxalase I; EC 4.4.1.5 from Oryza sativa subsp. japonica (Rice) (see paper)
50% identity, 98% coverage: 2:126/128 of query aligns to 24:149/291 of Q948T6
Sites not aligning to the query:
2c21A Specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme (see paper)
45% identity, 99% coverage: 2:128/128 of query aligns to 3:124/139 of 2c21A
P50107 Glyoxalase I; Glx I; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; actoylglutathione lyase; EC 4.4.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
40% identity, 96% coverage: 2:124/128 of query aligns to 182:320/326 of P50107
Sites not aligning to the query:
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
38% identity, 98% coverage: 3:127/128 of query aligns to 25:171/177 of 6l0uB
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
38% identity, 98% coverage: 3:127/128 of query aligns to 25:171/177 of 4kykB
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
38% identity, 98% coverage: 3:127/128 of query aligns to 24:170/176 of 3w0tA
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
38% identity, 98% coverage: 3:127/128 of query aligns to 24:170/176 of 3vw9A
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
38% identity, 98% coverage: 3:127/128 of query aligns to 24:170/176 of 1qipA
Sites not aligning to the query:
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
38% identity, 98% coverage: 3:127/128 of query aligns to 24:170/176 of 1qinA
Sites not aligning to the query:
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
38% identity, 98% coverage: 3:127/128 of query aligns to 24:170/176 of 1froA
Sites not aligning to the query:
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
38% identity, 98% coverage: 3:127/128 of query aligns to 27:173/179 of 4kykA
2za0A Crystal structure of mouse glyoxalase i complexed with methyl-gerfelin (see paper)
38% identity, 98% coverage: 3:127/128 of query aligns to 29:175/180 of 2za0A
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
38% identity, 98% coverage: 3:127/128 of query aligns to 32:178/184 of Q04760
Sites not aligning to the query:
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
38% identity, 98% coverage: 3:127/128 of query aligns to 24:170/175 of 3w0uA
Sites not aligning to the query:
>Dsui_1204 FitnessBrowser__PS:Dsui_1204
MRLLHTMLRVGDLDRSMAFYTEVLGMQQLRRQDYPDGRFTLAFVGYGPESEGAVIELTHN
WDTPAYELGNGFGHIALEVDDAYAACAAIKARGGKVVREAGPMKHGTTVIAFVEDPDGYK
IELIQKHS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory