Comparing Dsui_1220 FitnessBrowser__PS:Dsui_1220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
38% identity, 97% coverage: 10:413/418 of query aligns to 5:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
38% identity, 97% coverage: 10:413/418 of query aligns to 5:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
31% identity, 98% coverage: 2:411/418 of query aligns to 3:408/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
27% identity, 68% coverage: 116:399/418 of query aligns to 109:426/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
27% identity, 68% coverage: 116:399/418 of query aligns to 108:425/455 of 5j7iC
>Dsui_1220 FitnessBrowser__PS:Dsui_1220
MDIKDYMQNLGRRARAASRQMAKADTNAKNRALLAIAAAIRRDEAKLLAANGEDLAAARA
AGLEPAMVDRLTLSPKTVATMAEGLEQIASLPDPIGEMTDLRFRPSGIQVGHMRVPLGVI
GIIYEARPNVTVDAAGLCIKSGNASILRGGSEAIRCNQALATLVKEGLQSAGLPADAVQV
VETTDRAAVGELITMREFVDVIVPRGGKGLIARLLAESRVPMIQHLDGNCHVYLDDSADA
AKAMAVVENSKTQRYGTCNTAESLLVARSVAATLLPPIAAMLTAKGVEIRGCAETRALVP
NAKEATEADWGEEYLAPIIAVKVVAGLDEAIEHINKYSSSHTEAIVTENHTHAMRFLREV
DSASVMVNASTRFADGFEYGLGAEIGISTDKIHARGPVGLEGLTSQKWVVLGNGQVRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory