Comparing Dsui_1264 FitnessBrowser__PS:Dsui_1264 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
34% identity, 94% coverage: 6:208/216 of query aligns to 2:203/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
34% identity, 94% coverage: 6:208/216 of query aligns to 2:203/207 of 1h2eA
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
32% identity, 93% coverage: 6:206/216 of query aligns to 2:196/196 of 6m1xC
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 77% coverage: 4:169/216 of query aligns to 6:176/211 of P36623
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
31% identity, 93% coverage: 6:206/216 of query aligns to 2:196/198 of 5zr2C
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
32% identity, 73% coverage: 4:160/216 of query aligns to 211:358/432 of 1k6mA
Sites not aligning to the query:
P16118 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see paper)
32% identity, 73% coverage: 4:160/216 of query aligns to 250:397/471 of P16118
Sites not aligning to the query:
P07953 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Rattus norvegicus (Rat) (see 3 papers)
32% identity, 73% coverage: 4:160/216 of query aligns to 250:397/471 of P07953
Sites not aligning to the query:
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
27% identity, 93% coverage: 6:206/216 of query aligns to 2:200/207 of 4ij6A
1fbtA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
33% identity, 71% coverage: 8:160/216 of query aligns to 3:146/190 of 1fbtA
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
33% identity, 71% coverage: 8:160/216 of query aligns to 4:147/191 of 1tipA
Sites not aligning to the query:
1c81A Michaelis complex of fructose-2,6-bisphosphatase
33% identity, 71% coverage: 8:160/216 of query aligns to 4:147/191 of 1c81A
Sites not aligning to the query:
1c80A Regulatory complex of fructose-2,6-bisphosphatase
33% identity, 71% coverage: 8:160/216 of query aligns to 4:147/191 of 1c80A
Sites not aligning to the query:
1c7zA Regulatory complex of fructose-2,6-bisphosphatase
33% identity, 71% coverage: 8:160/216 of query aligns to 4:147/191 of 1c7zA
Sites not aligning to the query:
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
37% identity, 70% coverage: 7:158/216 of query aligns to 3:159/209 of 4qihA
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
37% identity, 70% coverage: 7:158/216 of query aligns to 4:160/217 of 4pzaB
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
37% identity, 70% coverage: 7:158/216 of query aligns to 5:161/223 of P9WIC7
Sites not aligning to the query:
3qpwA Pfkfb3 in complex with aluminum tetrafluoride (see paper)
34% identity, 72% coverage: 5:160/216 of query aligns to 237:383/431 of 3qpwA
Sites not aligning to the query:
6hviA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 2 (see paper)
34% identity, 72% coverage: 5:160/216 of query aligns to 232:378/433 of 6hviA
Sites not aligning to the query:
6etjA Human pfkfb3 in complex with kan0438241 (see paper)
34% identity, 72% coverage: 5:160/216 of query aligns to 233:379/432 of 6etjA
Sites not aligning to the query:
>Dsui_1264 FitnessBrowser__PS:Dsui_1264
MVKAPTRICVIRHGETFWNADRRIQGHLDIGLNPTGLRQARAAARRLAAEAGTVTAVYSS
DLARARVTAEAIAAHLGRPVCLRPALRERSYGIFEGLTYDEARQQHPGAYAAFEARQPEL
PIPQGESLEDFSARVSRCLEALAAEHRGETVVLVCHGGVLDVINRHVRGRPLAAPRDFTI
PNAGITWLERDGAGWRIVQWSCTRHLEDGALDELPG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory