Comparing Dsui_1398 FitnessBrowser__PS:Dsui_1398 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
59% identity, 96% coverage: 7:269/273 of query aligns to 4:262/262 of 7chaI
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
58% identity, 96% coverage: 7:269/273 of query aligns to 4:259/259 of 7ch8I
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
55% identity, 97% coverage: 3:266/273 of query aligns to 1:260/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
55% identity, 97% coverage: 3:266/273 of query aligns to 1:260/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
56% identity, 93% coverage: 5:258/273 of query aligns to 1:250/253 of 6z5uK
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
53% identity, 97% coverage: 5:270/273 of query aligns to 3:264/264 of 6xgyA
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
53% identity, 97% coverage: 5:270/273 of query aligns to 3:264/265 of 7ch6C
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
54% identity, 94% coverage: 5:260/273 of query aligns to 3:254/263 of 7cgnB
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 93% coverage: 3:256/273 of query aligns to 81:345/345 of Q9AT00
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 84% coverage: 6:234/273 of query aligns to 2:223/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 86% coverage: 24:258/273 of query aligns to 19:253/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 86% coverage: 24:258/273 of query aligns to 20:254/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 86% coverage: 24:258/273 of query aligns to 20:254/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 86% coverage: 24:258/273 of query aligns to 20:254/344 of 3tuiC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 88% coverage: 6:246/273 of query aligns to 17:248/378 of P69874
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 78% coverage: 21:234/273 of query aligns to 14:225/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 78% coverage: 21:234/273 of query aligns to 14:225/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 78% coverage: 21:234/273 of query aligns to 14:225/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 78% coverage: 21:234/273 of query aligns to 14:225/242 of 2oljA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 82% coverage: 30:252/273 of query aligns to 46:269/382 of 7ahhC
Sites not aligning to the query:
>Dsui_1398 FitnessBrowser__PS:Dsui_1398
MPTESLVEIRGLNFAYDTDSGPRKVLEGIDMSFHKGKVVAIMGGSGCGKTTLLRLIGGQL
RPSAGEVKVAGHAVHRMNTRELYALRRRMGMLFQFGALFTDMSVFDNVAFQMREHTDLPE
ELIRDMVLLKLQAVGLRGAAGLMPNELSGGMARRVALARAVALDPMLIMYDEPFTGLDPI
SLGVIGQLIRKLNDALGATSIMVTHDIQESLQIVDYIYFMSAGRVVAQGTPDEIRASRDP
FVHQFVHAEADGPVPFHYPAVSVADSLLGGVRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory