Comparing Dsui_1462 FitnessBrowser__PS:Dsui_1462 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
47% identity, 85% coverage: 40:265/267 of query aligns to 1:230/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
47% identity, 85% coverage: 40:265/267 of query aligns to 1:230/230 of 1l2tA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
49% identity, 83% coverage: 40:260/267 of query aligns to 3:222/226 of 5xu1B
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
46% identity, 82% coverage: 39:258/267 of query aligns to 3:221/648 of P75831
7arlD Lolcde in complex with lipoprotein and adp (see paper)
46% identity, 83% coverage: 40:260/267 of query aligns to 2:222/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
46% identity, 83% coverage: 40:260/267 of query aligns to 5:225/233 of P75957
7mdyC Lolcde nucleotide-bound
46% identity, 83% coverage: 40:260/267 of query aligns to 2:222/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
46% identity, 83% coverage: 40:260/267 of query aligns to 4:224/229 of 7v8iD
8g4cB Bceabs atpgs high res tm (see paper)
43% identity, 82% coverage: 44:261/267 of query aligns to 7:224/248 of 8g4cB
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
43% identity, 85% coverage: 40:265/267 of query aligns to 3:227/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
43% identity, 85% coverage: 40:265/267 of query aligns to 3:227/592 of 5lj7A
7tchB Bceab e169q variant atp-bound conformation (see paper)
42% identity, 82% coverage: 44:261/267 of query aligns to 6:223/245 of 7tchB
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
43% identity, 82% coverage: 40:258/267 of query aligns to 4:221/650 of 5ws4A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
45% identity, 75% coverage: 59:258/267 of query aligns to 18:216/223 of 2pclA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 82% coverage: 40:258/267 of query aligns to 1:219/343 of P30750
Sites not aligning to the query:
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 79% coverage: 43:253/267 of query aligns to 6:215/330 of P9WQK5
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
41% identity, 75% coverage: 40:240/267 of query aligns to 2:201/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
41% identity, 75% coverage: 40:240/267 of query aligns to 2:201/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
41% identity, 75% coverage: 40:240/267 of query aligns to 2:201/344 of 6cvlD
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
40% identity, 81% coverage: 40:254/267 of query aligns to 2:211/220 of 8tzjA
>Dsui_1462 FitnessBrowser__PS:Dsui_1462
MSGAVDGSAAAGSVLNAVGHQAGLGAGTGDTGSGTPAAPLIVLDNLSKSYRRGQQVVPVL
ERISFNIAAGEFLALMGPSGSGKSTLLNLIAGIDRPDSGTLSVAGQDIAALEEAELAAWR
AENVGFIFQFYNLMPVLTALENVELPLLLKNLGKAERRERAELALSMVGLADRMDHTPNE
LSGGQQQRVAIARALITDPTLIVADEPTGDLDRESAGDILHLLQRLNDELGKTIVMVTHD
QRAAESAHAIMHLEKGELSARQEIRPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory