SitesBLAST
Comparing Dsui_1637 FitnessBrowser__PS:Dsui_1637 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
7e1sC Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with octanoyl-acp (see paper)
34% identity, 98% coverage: 4:381/387 of query aligns to 6:366/366 of 7e1sC
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: L104 (≠ M101), A129 (= A126), G130 (= G127), L131 (= L128), I150 (= I147), I151 (≠ L148), S152 (= S149), E178 (= E174), H185 (= H182), Y280 (≠ L283), I324 (= I338), L328 (= L342)
- binding flavin mononucleotide: G25 (= G22), G26 (= G23), M27 (= M24), G28 (= G25), N102 (= N99), E178 (= E174), S182 (≠ A179), G183 (= G180), G223 (= G225), G224 (= G226), M244 (≠ L246), A245 (≠ G247), T246 (≠ S248), L249 (≠ A251), F342 (= F356), T343 (≠ R357)
- binding iron/sulfur cluster: C303 (≠ L316), N306 (≠ D319), C307 (= C320), V308 (≠ L321), C311 (= C324), G314 (≠ D328), A317 (≠ P331), C323 (= C337), I324 (= I338)
- binding : L131 (= L128), T133 (≠ L130), N134 (≠ D131), K155 (≠ R152), I159 (≠ L156), K162 (= K159), R163 (≠ K160), R167 (= R163)
7e1sA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with octanoyl-acp (see paper)
34% identity, 98% coverage: 4:381/387 of query aligns to 6:366/366 of 7e1sA
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: L104 (≠ M101), A129 (= A126), G130 (= G127), I150 (= I147), I151 (≠ L148), S152 (= S149), E178 (= E174), H185 (= H182), G187 (= G184), Y280 (≠ L283), L328 (= L342)
- binding flavin mononucleotide: G25 (= G22), G26 (= G23), M27 (= M24), G28 (= G25), N102 (= N99), L104 (≠ M101), E178 (= E174), G183 (= G180), G223 (= G225), G224 (= G226), Q243 (= Q245), M244 (≠ L246), A245 (≠ G247), T246 (≠ S248)
- binding iron/sulfur cluster: C303 (≠ L316), N306 (≠ D319), C307 (= C320), V308 (≠ L321), C311 (= C324), G314 (≠ D328), A317 (≠ P331), C323 (= C337), I324 (= I338)
7e1rA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with holo-acp (see paper)
34% identity, 98% coverage: 4:381/387 of query aligns to 6:366/366 of 7e1rA
- binding flavin mononucleotide: G25 (= G22), G26 (= G23), M27 (= M24), G28 (= G25), N102 (= N99), L104 (≠ M101), E178 (= E174), G183 (= G180), G224 (= G226), Q243 (= Q245), M244 (≠ L246), A245 (≠ G247), T246 (≠ S248), F342 (= F356)
- binding N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide: G128 (= G125), A129 (= A126), G130 (= G127), E178 (= E174), H185 (= H182), G187 (= G184)
- binding iron/sulfur cluster: C303 (≠ L316), N306 (≠ D319), C307 (= C320), V308 (≠ L321), C311 (= C324), G314 (≠ D328), A317 (≠ P331), C323 (= C337), I324 (= I338)
7e1qA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori (see paper)
34% identity, 98% coverage: 4:381/387 of query aligns to 6:366/366 of 7e1qA
- binding flavin mononucleotide: G25 (= G22), G26 (= G23), M27 (= M24), G28 (= G25), N102 (= N99), L104 (≠ M101), E178 (= E174), S182 (≠ A179), G183 (= G180), G223 (= G225), G224 (= G226), M244 (≠ L246), A245 (≠ G247), T246 (≠ S248), F342 (= F356)
- binding iron/sulfur cluster: P277 (≠ C280), C303 (≠ L316), N306 (≠ D319), C307 (= C320), V308 (≠ L321), C311 (= C324), G314 (≠ D328), A317 (≠ P331), C323 (= C337), I324 (= I338)
7l00C Crystal structure of c. Difficile enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
25% identity, 95% coverage: 18:386/387 of query aligns to 19:310/315 of 7l00C
- binding flavin mononucleotide: G23 (= G22), G24 (= G23), M25 (= M24), A26 (≠ G25), N74 (= N99), E142 (≠ H175), G146 (≠ A179), G147 (= G180), G174 (= G225), G175 (= G226), Q194 (= Q245), G196 (= G247), T197 (≠ S248), M281 (≠ F356), S285 (= S360)
- binding N-[6-(methylsulfonyl)-1,3-benzothiazol-2-yl]-2-[2-(1H-pyrrol-1-yl)-1,3-thiazol-4-yl]acetamide: A26 (≠ G25), M76 (= M101), G100 (= G125), A101 (= A126), G102 (= G127), V121 (≠ L144), P123 (= P146), H149 (= H182), L266 (≠ W318), M281 (≠ F356)
6bkaA Crystal structure of nitronate monooxygenase from cyberlindnera saturnus (see paper)
24% identity, 71% coverage: 18:293/387 of query aligns to 17:306/374 of 6bkaA
- binding 3,6,9,12,15,18,21,24,27,30,33,36-dodecaoxaoctatriacontane-1,38-diol: T34 (= T36), R37 (≠ S39), V67 (≠ M59), D69 (≠ E61)
- binding flavin mononucleotide: A21 (≠ G22), P22 (≠ G23), M23 (= M24), A24 (≠ G25), N77 (≠ E69), F79 (≠ I71), H147 (≠ T136), Q190 (≠ E174), A194 (= A179), G195 (= G180), G196 (= G181), G239 (= G225), G240 (= G226), G261 (= G247), T262 (≠ S248)
5lsmA Crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1
32% identity, 33% coverage: 161:288/387 of query aligns to 154:270/339 of 5lsmA
Sites not aligning to the query:
2z6iB Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) (see paper)
26% identity, 66% coverage: 98:352/387 of query aligns to 68:291/321 of 2z6iB
- binding calcium ion: E137 (= E174), H144 (= H182), A158 (≠ L206), I161 (≠ F209)
- binding flavin mononucleotide: N69 (= N99), E137 (= E174), A141 (= A179), G142 (= G180), G169 (= G225), G170 (= G226), G191 (= G247), T192 (≠ S248), M281 (≠ L342)
Sites not aligning to the query:
2z6jA Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor (see paper)
28% identity, 50% coverage: 98:290/387 of query aligns to 68:231/307 of 2z6jA
- binding calcium ion: A158 (≠ L206), I161 (≠ F209)
- binding flavin mononucleotide: N69 (= N99), E137 (= E174), A141 (= A179), G142 (= G180), G169 (= G225), G170 (= G226), G191 (= G247), T192 (≠ S248)
- binding 2-(4-(2-((3-(5-(pyridin-2-ylthio)thiazol-2-yl)ureido)methyl)-1h-imidazol-4-yl)phenoxy)acetic acid: M71 (= M101), L73 (≠ A103), A96 (= A126), G97 (= G127), V116 (≠ I147), P118 (≠ S149), L122 (= L158), E137 (= E174), H144 (= H182)
Sites not aligning to the query:
5gvhA Structure of fabk from thermotoga maritima (see paper)
27% identity, 42% coverage: 216:379/387 of query aligns to 161:297/311 of 5gvhA
Sites not aligning to the query:
4q4kA Crystal structure of nitronate monooxygenase from pseudomonas aeruginosa pao1 (see paper)
30% identity, 19% coverage: 215:288/387 of query aligns to 207:280/351 of 4q4kA
Sites not aligning to the query:
- binding flavin mononucleotide: 18, 19, 20, 21, 69, 71, 133, 176, 180, 181, 182, 325
Q9HWH9 Nitronate monooxygenase; NMO; Propionate 3-nitronate monooxygenase; P3N monooxygenase; EC 1.13.12.- from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
30% identity, 19% coverage: 215:288/387 of query aligns to 207:280/351 of Q9HWH9
Sites not aligning to the query:
- 21 binding
- 69 binding
- 176 binding
- 181 binding
4qiuB Crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form
30% identity, 19% coverage: 215:288/387 of query aligns to 206:279/350 of 4qiuB
Sites not aligning to the query:
- binding flavin mononucleotide: 17, 18, 19, 20, 68, 70, 132, 175, 179, 180, 181, 324
- binding 1-nitropropane: 20, 324
4qitA Crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form
30% identity, 19% coverage: 215:288/387 of query aligns to 207:280/350 of 4qitA
Sites not aligning to the query:
- binding flavin mononucleotide: 18, 19, 20, 21, 69, 71, 133, 176, 180, 181, 325
- binding nitroethane: 71, 182, 183, 325
Query Sequence
>Dsui_1637 FitnessBrowser__PS:Dsui_1637
MSSTAFPPLKIKGKTLVPIVQGGMGVGISAHRLAGTVASLNGVGTIASVDLRRHHPDLMA
ETGRSRNREAIEKANLIALDREIKMAQDIAQGRGVIAVNVMRAVTQYQDYVRQSCQSGAE
AIVMGAGLPLDLPELTEGYPDVALVPILSDVRGIVLLLKKWMRKNRLPDAIVIEHPRYAG
GHLGAAKKEDVNDPRFNFEVVIPGVLEAFEEMGIASEKIPLIPAGGINSHERVRELIDMG
AAAVQLGSAFAVAEEGDADIEFKKVLAGAKDKDVVDFMSCAGLPARAVKTPWLEKYLNRE
EKLMAAAAGKEHKCTLAWDCLLQCGLRDSNPKHGQFCIDNQLAAAVTGDVQKGLFFRGAS
SLPFGSAIRPVRELMHYLLTGEKPVFT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory