SitesBLAST
Comparing Dsui_1668 FitnessBrowser__PS:Dsui_1668 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
46% identity, 93% coverage: 20:365/374 of query aligns to 12:363/365 of Q8Z0C8
- M82 (≠ V90) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (= L120) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (≠ I217) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
Q07523 2-Hydroxyacid oxidase 2; HAOX2; (S)-2-hydroxy-acid oxidase, peroxisomal; Long chain alpha-hydroxy acid oxidase; Long-chain L-2-hydroxy acid oxidase; LCHAO; EC 1.1.3.15 from Rattus norvegicus (Rat) (see 4 papers)
41% identity, 94% coverage: 15:365/374 of query aligns to 3:348/353 of Q07523
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
42% identity, 94% coverage: 15:365/374 of query aligns to 2:342/344 of 5qihA
- active site: Y129 (= Y141), D157 (= D169), H242 (= H265)
- binding flavin mononucleotide: Y23 (= Y36), Y24 (≠ L37), A76 (≠ P89), T77 (≠ V90), A78 (= A91), S105 (= S118), Q127 (= Q139), Y129 (= Y141), K218 (= K241), H242 (= H265), G243 (= G266), R245 (= R268), D273 (= D296), G274 (= G297), R277 (= R300), G296 (= G319), R297 (= R320)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y36), A78 (= A91), M79 (≠ H92), W107 (≠ L120), Y129 (= Y141), M180 (≠ P192), L187 (≠ M198), H242 (= H265)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
42% identity, 94% coverage: 15:365/374 of query aligns to 2:342/344 of 5qidA
- active site: Y129 (= Y141), D157 (= D169), H242 (= H265)
- binding flavin mononucleotide: Y23 (= Y36), Y24 (≠ L37), A76 (≠ P89), T77 (≠ V90), A78 (= A91), S105 (= S118), Q127 (= Q139), Y129 (= Y141), K218 (= K241), H242 (= H265), G243 (= G266), R245 (= R268), D273 (= D296), G274 (= G297), R277 (= R300), G296 (= G319), R297 (= R320)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ G70), E320 (= E343), R323 (≠ E346)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
42% identity, 94% coverage: 15:365/374 of query aligns to 2:342/344 of 5qicA
- active site: Y129 (= Y141), D157 (= D169), H242 (= H265)
- binding flavin mononucleotide: Y23 (= Y36), Y24 (≠ L37), A76 (≠ P89), T77 (≠ V90), A78 (= A91), S105 (= S118), Q127 (= Q139), Y129 (= Y141), K218 (= K241), H242 (= H265), G243 (= G266), R245 (= R268), D273 (= D296), G274 (= G297), R277 (= R300), G296 (= G319), R297 (= R320)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (≠ Q143), K132 (≠ P144), V136 (≠ F148), M180 (≠ P192), F183 (≠ L195), Y190 (≠ P201), K193 (≠ P204), A194 (= A205)
5qibA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with fmopl000388a
42% identity, 94% coverage: 15:365/374 of query aligns to 2:342/344 of 5qibA
- active site: Y129 (= Y141), D157 (= D169), H242 (= H265)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: Y23 (= Y36), Y24 (≠ L37), A76 (≠ P89), T77 (≠ V90), A78 (= A91), S105 (= S118), Q127 (= Q139), Y129 (= Y141), K218 (= K241), H242 (= H265), G243 (= G266), R245 (= R268), D273 (= D296), G274 (= G297), G275 (= G298), R277 (= R300), G296 (= G319), R297 (= R320)
- binding 5-(cyclohexylamino)pyrimidine-2,4(1H,3H)-dione: Y23 (= Y36), M79 (≠ H92), W107 (≠ L120), Y129 (= Y141), R164 (= R176), M180 (≠ P192), L187 (≠ M198), H242 (= H265), R245 (= R268)
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
41% identity, 95% coverage: 11:365/374 of query aligns to 2:360/362 of 6gmbA
- active site: Y132 (= Y141), D160 (= D169), H260 (= H265)
- binding flavin mononucleotide: Y26 (= Y36), Y27 (≠ L37), A79 (≠ P89), T80 (≠ V90), A81 (= A91), S108 (= S118), Q130 (= Q139), Y132 (= Y141), K236 (= K241), H260 (= H265), G261 (= G266), R263 (= R268), D291 (= D296), G292 (= G297), G293 (= G298), R295 (= R300), G314 (= G319), R315 (= R320)
- binding glycolic acid: Y26 (= Y36), W110 (≠ L120), Y132 (= Y141), R167 (= R176), H260 (= H265), R263 (= R268)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
41% identity, 95% coverage: 11:365/374 of query aligns to 2:360/370 of Q9UJM8
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
42% identity, 95% coverage: 11:365/374 of query aligns to 1:350/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y36), A80 (= A91), M81 (≠ H92), W109 (≠ L120), Y131 (= Y141), R166 (= R176), M182 (≠ P192), H250 (= H265), R253 (= R268)
- binding flavin mononucleotide: Y25 (= Y36), Y26 (≠ L37), A78 (≠ P89), T79 (≠ V90), A80 (= A91), S107 (= S118), W109 (≠ L120), Q129 (= Q139), Y131 (= Y141), T157 (= T167), K226 (= K241), H250 (= H265), G251 (= G266), R253 (= R268), D281 (= D296), G282 (= G297), R285 (= R300), G304 (= G319), R305 (= R320)
7r4oA Structure of human hydroxyacid oxidase 1 bound with 2-((4h-1,2,4- triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one
42% identity, 95% coverage: 12:365/374 of query aligns to 1:339/341 of 7r4oA
- binding flavin mononucleotide: Y25 (≠ L37), A77 (≠ P89), T78 (≠ V90), A79 (= A91), S106 (= S118), Q128 (= Q139), Y130 (= Y141), K215 (= K241), H239 (= H265), G240 (= G266), R242 (= R268), D270 (= D296), G271 (= G297), R274 (= R300), G293 (= G319), R294 (= R320)
- binding 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one: Y132 (≠ Q143), K133 (≠ P144), D134 (= D145), N183 (≠ G197), K190 (≠ P204)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
41% identity, 94% coverage: 15:365/374 of query aligns to 2:357/359 of 5qigA
- active site: Y129 (= Y141), D157 (= D169), H257 (= H265)
- binding flavin mononucleotide: Y23 (= Y36), Y24 (≠ L37), A76 (≠ P89), T77 (≠ V90), A78 (= A91), S105 (= S118), Q127 (= Q139), Y129 (= Y141), T155 (= T167), K233 (= K241), H257 (= H265), G258 (= G266), R260 (= R268), D288 (= D296), G289 (= G297), G290 (= G298), R292 (= R300), G311 (= G319), R312 (= R320)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: L2 (≠ I15), R223 (= R231), G248 (= G256), F320 (≠ A328), K324 (≠ L332), D328 (≠ H336)
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
41% identity, 94% coverage: 15:365/374 of query aligns to 2:357/359 of 5qifA
- active site: Y129 (= Y141), D157 (= D169), H257 (= H265)
- binding flavin mononucleotide: Y23 (= Y36), Y24 (≠ L37), A76 (≠ P89), T77 (≠ V90), A78 (= A91), S105 (= S118), Q127 (= Q139), Y129 (= Y141), K233 (= K241), H257 (= H265), G258 (= G266), R260 (= R268), D288 (= D296), G289 (= G297), R292 (= R300), G311 (= G319), R312 (= R320)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R231), R224 (≠ S232), S227 (≠ R235)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
41% identity, 94% coverage: 15:365/374 of query aligns to 2:357/359 of 2rdwA
- active site: S105 (= S118), Y129 (= Y141), T155 (= T167), D157 (= D169), K233 (= K241), H257 (= H265)
- binding flavin mononucleotide: Y23 (= Y36), Y24 (≠ L37), A76 (≠ P89), T77 (≠ V90), A78 (= A91), Q127 (= Q139), Y129 (= Y141), T155 (= T167), K233 (= K241), H257 (= H265), G258 (= G266), R260 (= R268), D288 (= D296), G289 (= G297), R292 (= R300), G311 (= G319), R312 (= R320)
- binding sulfate ion: Y23 (= Y36), W107 (≠ L120), R164 (= R176), H257 (= H265), R260 (= R268)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
42% identity, 95% coverage: 12:365/374 of query aligns to 1:358/360 of 2rduA
- active site: S106 (= S118), Y130 (= Y141), T156 (= T167), D158 (= D169), K234 (= K241), H258 (= H265)
- binding flavin mononucleotide: Y24 (= Y36), Y25 (≠ L37), A77 (≠ P89), T78 (≠ V90), A79 (= A91), S106 (= S118), Q128 (= Q139), Y130 (= Y141), T156 (= T167), K234 (= K241), H258 (= H265), G259 (= G266), R261 (= R268), D289 (= D296), G290 (= G297), G291 (= G298), R293 (= R300), G312 (= G319), R313 (= R320)
- binding glyoxylic acid: Y24 (= Y36), W108 (≠ L120), Y130 (= Y141), R165 (= R176), H258 (= H265), R261 (= R268)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
42% identity, 93% coverage: 14:361/374 of query aligns to 2:350/369 of P05414
- Y24 (= Y36) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (≠ PVA 89:91) binding
- S106 (= S118) binding
- W108 (≠ L120) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (= QLY 139:141) binding
- T155 (= T167) binding
- K230 (= K241) binding
- S252 (= S263) binding
- DGGVR 285:289 (≠ DGGIR 296:300) binding
- GR 308:309 (= GR 319:320) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2w0uA Crystal structure of human glycolate oxidase in complex with the inhibitor 5-[(4-chlorophenyl)sulfanyl]- 1,2,3-thiadiazole-4- carboxylate. (see paper)
42% identity, 94% coverage: 15:365/374 of query aligns to 1:331/334 of 2w0uA
- active site: S104 (= S118), Y128 (= Y141), T154 (= T167), D156 (= D169), K207 (= K241), H231 (= H265)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y22 (= Y36), M78 (≠ H92), W106 (≠ L120), Y128 (= Y141), R163 (= R176), L176 (≠ M198), Y179 (≠ P201), V180 (≠ A202), H231 (= H265), R234 (= R268)
- binding flavin mononucleotide: Y23 (≠ L37), A75 (≠ P89), T76 (≠ V90), A77 (= A91), S104 (= S118), Q126 (= Q139), T154 (= T167), K207 (= K241), H231 (= H265), G232 (= G266), R234 (= R268), D262 (= D296), G263 (= G297), R266 (= R300), G285 (= G319), R286 (= R320)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
41% identity, 95% coverage: 11:365/374 of query aligns to 2:358/360 of 6gmcA
- active site: Y132 (= Y141), D160 (= D169), H258 (= H265)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y36), M82 (≠ H92), W110 (≠ L120), Y132 (= Y141), R167 (= R176), F191 (≠ L206), L203 (≠ M218), Y206 (vs. gap), H258 (= H265), R261 (= R268)
- binding flavin mononucleotide: Y26 (= Y36), Y27 (≠ L37), A79 (≠ P89), T80 (≠ V90), A81 (= A91), S108 (= S118), Q130 (= Q139), Y132 (= Y141), T158 (= T167), K234 (= K241), H258 (= H265), G259 (= G266), R261 (= R268), D289 (= D296), G290 (= G297), R293 (= R300), G312 (= G319), R313 (= R320)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
41% identity, 94% coverage: 15:365/374 of query aligns to 2:351/353 of 5qieA
- active site: Y129 (= Y141), D157 (= D169), H251 (= H265)
- binding flavin mononucleotide: Y23 (= Y36), Y24 (≠ L37), A76 (≠ P89), T77 (≠ V90), A78 (= A91), S105 (= S118), Q127 (= Q139), Y129 (= Y141), K227 (= K241), H251 (= H265), G252 (= G266), R254 (= R268), D282 (= D296), G283 (= G297), R286 (= R300), G305 (= G319), R306 (= R320)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: I3 (≠ A16), D322 (≠ H336)
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
42% identity, 93% coverage: 14:361/374 of query aligns to 2:341/350 of 1al7A
- active site: S106 (= S118), Y129 (= Y141), T155 (= T167), D157 (= D169), K221 (= K241), H245 (= H265)
- binding flavin mononucleotide: Y24 (= Y36), Y25 (≠ L37), P77 (= P89), T78 (≠ V90), A79 (= A91), S106 (= S118), Q127 (= Q139), T155 (= T167), K221 (= K241), H245 (= H265), R248 (= R268), D276 (= D296), G277 (= G297), R280 (= R300), G299 (= G319), R300 (= R320)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (= Y36), W108 (≠ L120), Y129 (= Y141), R164 (= R176), F172 (= F184), I198 (≠ M218), H245 (= H265), R248 (= R268)
7r4pA Structure of human hydroxyacid oxidase 1 bound with 6-amino-1-benzyl- 5-(methylamino)pyrimidine-2,4(1h,3h)-dione
42% identity, 95% coverage: 12:365/374 of query aligns to 1:335/337 of 7r4pA
- binding flavin mononucleotide: Y25 (≠ L37), A77 (≠ P89), T78 (≠ V90), A79 (= A91), S106 (= S118), Q128 (= Q139), Y130 (= Y141), T156 (= T167), K211 (= K241), H235 (= H265), G236 (= G266), R238 (= R268), D266 (= D296), G267 (= G297), R270 (= R300), G289 (= G319), R290 (= R320)
- binding 6-amino-1-benzyl-5-(methylamino)pyrimidine-2,4(1H,3H)-dione: Y24 (= Y36), A79 (= A91), M80 (≠ H92), W108 (≠ L120), Y130 (= Y141), R165 (= R176), L180 (≠ M198), H235 (= H265), R238 (= R268)
Query Sequence
>Dsui_1668 FitnessBrowser__PS:Dsui_1668
MAFNAPLLERIPREIAAVGDYEPYARRRLDDNAWTYLHSGSADELTFRWNKEAFDRLRLN
GRVLADVRGGHTRLELFGQRYEHPLFLAPVAHQKLFHPEGELATVLGAGALQAGMVVSTL
ASTPLEDIAAQAEAPLWFQLYFQPDRDFTRQLVQRAEAAGYQALVVTVDVPIFGLRNREQ
RIGFHLPAGIDPANLRGMAAPAQPALHPGQSIVFDGIMAAAPTWEDIAWVRSLTRLPLIL
KGITHPGDARQAADLGVDGLIVSNHGGRSLDTLPASIEALPAVVQAVAGRLPVLLDGGIR
RGSDVVKALALGAAAVLLGRPWVYGLAAAGPLGVAHTLKLLREELEVTMAMAGCTTLADI
NADLLFSHHTWMQP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory