SitesBLAST
Comparing Dsui_1825 FitnessBrowser__PS:Dsui_1825 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
30% identity, 47% coverage: 5:383/812 of query aligns to 2:402/424 of 8c0zE
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
34% identity, 45% coverage: 5:372/812 of query aligns to 2:343/359 of Q8U1K9
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
36% identity, 41% coverage: 5:337/812 of query aligns to 2:317/346 of 1xhcA
- active site: P10 (≠ M13), K38 (≠ R45), P39 (≠ I46), F145 (≠ L155), E149 (= E159), M276 (≠ F295)
- binding flavin-adenine dinucleotide: V6 (= V9), G7 (= G10), G9 (= G12), P10 (≠ M13), G11 (≠ A14), D29 (≠ G36), K30 (≠ A37), K38 (≠ R45), P39 (≠ I46), E74 (≠ K81), A75 (≠ V82), A100 (= A108), T101 (= T109), G102 (= G110), L119 (≠ Y129), R120 (= R130), F145 (≠ L155), I146 (≠ L156), E149 (= E159), G259 (= G278), D260 (≠ E279), G270 (= G289), T271 (≠ L290), A272 (≠ V291)
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
32% identity, 34% coverage: 6:282/812 of query aligns to 4:277/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G12), V11 (≠ M13), G12 (≠ A14), D34 (≠ A37), E35 (= E38), R42 (= R45), P43 (≠ I46), K47 (vs. gap), E78 (≠ K81), V79 (= V82), T106 (= T109), G107 (= G110), G273 (= G278), D274 (≠ E279)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ F114), G149 (= G152), L152 (= L155), I153 (≠ L156), E156 (= E159), E172 (≠ H175), A173 (≠ V176), R180 (= R183), V236 (= V241), G237 (= G242), A238 (≠ I243)
Sites not aligning to the query:
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
32% identity, 34% coverage: 6:282/812 of query aligns to 5:278/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G12), V12 (≠ M13), G13 (≠ A14), D35 (≠ A37), E36 (= E38), R43 (= R45), P44 (≠ I46), S47 (= S49), K48 (vs. gap), V80 (= V82), T107 (= T109), G108 (= G110), R128 (= R130), G274 (= G278), D275 (≠ E279)
Sites not aligning to the query:
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
33% identity, 31% coverage: 32:283/812 of query aligns to 31:283/409 of 3lxdA
- active site: R44 (= R45), P45 (≠ I46)
- binding flavin-adenine dinucleotide: R36 (≠ A37), E37 (= E38), R44 (= R45), P45 (≠ I46), S48 (= S49), K49 (≠ P50), E81 (≠ K81), V82 (= V82), T109 (= T109), I157 (≠ L156), G278 (= G278), D279 (≠ E279)
Sites not aligning to the query:
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 31% coverage: 31:282/812 of query aligns to 32:299/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
30% identity, 37% coverage: 5:307/812 of query aligns to 6:318/422 of P16640
- A15 (= A14) binding
- D37 (≠ G36) binding
- K50 (≠ S49) binding
- V83 (= V82) binding
- R134 (vs. gap) binding
- D284 (≠ E279) binding
- V302 (= V291) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
30% identity, 37% coverage: 5:307/812 of query aligns to 5:317/422 of 1q1wA
- active site: L13 (≠ M13), L44 (≠ N44), P45 (≠ R45), L305 (≠ F295)
- binding flavin-adenine dinucleotide: G10 (= G10), G12 (= G12), L13 (≠ M13), A14 (= A14), G35 (≠ F35), D36 (≠ G36), L44 (≠ N44), P45 (≠ R45), K49 (≠ S49), V82 (= V82), A108 (= A108), T109 (= T109), G110 (= G110), R133 (vs. gap), I159 (≠ L156), D283 (≠ E279), S300 (≠ L290), V301 (= V291)
Sites not aligning to the query:
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
30% identity, 34% coverage: 32:307/812 of query aligns to 29:309/404 of 3fg2P
- binding flavin-adenine dinucleotide: D34 (≠ A37), E35 (= E38), R42 (= R45), P43 (≠ I46), S46 (= S49), K47 (≠ P50), R78 (≠ K81), M79 (≠ V82), T106 (= T109), R127 (= R130), I153 (≠ L156), D275 (≠ E279), S292 (≠ L290), V293 (= V291)
Sites not aligning to the query:
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
30% identity, 38% coverage: 31:335/812 of query aligns to 29:334/443 of 6rvhA
- active site: V39 (≠ P41), C44 (≠ I46), E53 (= E55), E58 (≠ P59), Y159 (≠ L155), E163 (= E159)
- binding coenzyme a: S40 (≠ N42), Y41 (= Y43), C44 (≠ I46), R63 (≠ N64), N303 (≠ A302), R307 (= R312)
- binding flavin-adenine dinucleotide: E34 (≠ G36), K35 (≠ A37), A43 (≠ R45), C44 (≠ I46), V81 (= V82), T113 (= T109), G114 (= G110), R134 (= R130), Y159 (≠ L155), G280 (= G278), D281 (≠ E279), P297 (= P293), L298 (= L294), G299 (≠ A298)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 20, 23, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
30% identity, 38% coverage: 31:335/812 of query aligns to 29:334/443 of 6rvbA
- active site: V39 (≠ P41), C44 (≠ I46), E53 (= E55), E58 (≠ P59), Y159 (≠ L155), E163 (= E159)
- binding coenzyme a: S40 (≠ N42), Y41 (= Y43), C44 (≠ I46), R63 (≠ N64), N303 (≠ A302), R307 (= R312)
- binding flavin-adenine dinucleotide: Y33 (≠ F35), E34 (≠ G36), K35 (≠ A37), S36 (≠ E38), A43 (≠ R45), C44 (≠ I46), E80 (≠ K81), V81 (= V82), T113 (= T109), G114 (= G110), L133 (≠ Y129), R134 (= R130), I160 (≠ L156), G280 (= G278), D281 (≠ E279), L298 (= L294), G299 (≠ A298)
- binding nicotinamide-adenine-dinucleotide: G156 (= G152), G158 (= G154), Y159 (≠ L155), I160 (≠ L156), E179 (≠ H175), A180 (≠ V176), A240 (= A240), T241 (≠ V241), G242 (= G242), P297 (= P293), I328 (≠ L329), F329 (= F330)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 20, 23, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
30% identity, 38% coverage: 31:335/812 of query aligns to 29:334/443 of 6ruzA
- active site: V39 (≠ P41), C44 (≠ I46), E53 (= E55), E58 (≠ P59), Y159 (≠ L155), E163 (= E159)
- binding coenzyme a: S40 (≠ N42), Y41 (= Y43), C44 (≠ I46), R63 (≠ N64), N303 (≠ A302), R307 (= R312)
- binding flavin-adenine dinucleotide: Y33 (≠ F35), E34 (≠ G36), K35 (≠ A37), A43 (≠ R45), C44 (≠ I46), E80 (≠ K81), V81 (= V82), T113 (= T109), G114 (= G110), A115 (≠ S111), L133 (≠ Y129), R134 (= R130), Y159 (≠ L155), G280 (= G278), D281 (≠ E279), P297 (= P293), L298 (= L294), G299 (≠ A298)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 19, 20, 23, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
28% identity, 41% coverage: 5:333/812 of query aligns to 2:338/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (≠ V9), G7 (= G10), V9 (≠ G12), G11 (≠ A14), E32 (≠ G36), K33 (≠ A37), C42 (≠ I46), V80 (= V82), S109 (≠ A108), P110 (≠ T109), G111 (= G110), I159 (≠ L156), G278 (= G278), D279 (≠ E279), S295 (≠ G289), L296 (= L290), A297 (≠ V291)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ E20), R18 (≠ E21), R21 (≠ K24), F70 (≠ N72), R305 (≠ K299)
Sites not aligning to the query:
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
30% identity, 38% coverage: 3:307/812 of query aligns to 1:302/381 of 2v3aA
- active site: L11 (≠ M13), K42 (≠ R45), P43 (≠ I46), M290 (≠ F295)
- binding flavin-adenine dinucleotide: I7 (≠ V9), G8 (= G10), T9 (≠ N11), G10 (= G12), A12 (= A14), T33 (≠ G36), A34 (= A37), D35 (≠ E38), K42 (≠ R45), P43 (≠ I46), R79 (≠ K81), V80 (= V82), A105 (= A108), W106 (≠ T109), G107 (= G110), I153 (≠ L156), F157 (≠ A160), D274 (≠ E279), L284 (≠ G289), Y285 (≠ L290), V286 (= V291)
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
31% identity, 31% coverage: 83:333/812 of query aligns to 87:346/541 of 6pfzA
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
30% identity, 38% coverage: 3:307/812 of query aligns to 4:305/384 of Q9HTK9
Sites not aligning to the query:
Q9AL95 NADH-rubredoxin oxidoreductase; NROR; NADH:rubredoxin oxidoreductase; EC 1.18.1.1 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
26% identity, 49% coverage: 1:396/812 of query aligns to 1:369/379 of Q9AL95
- C26 (≠ A26) modified: Disulfide link with 286
- NSE 33:35 (≠ GAE 36:38) binding
- R42 (= R45) binding
- A79 (≠ V82) binding
- Y125 (≠ R130) binding
- C137 (≠ A142) modified: Disulfide link with 216
- C216 (≠ L236) modified: Disulfide link with 137
- D259 (≠ E279) binding
- C286 (≠ A306) modified: Disulfide link with 26
3kljA Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum (see paper)
26% identity, 48% coverage: 5:396/812 of query aligns to 4:368/378 of 3kljA
- active site: P12 (≠ M13), R41 (= R45), P42 (≠ I46), N274 (≠ F295)
- binding flavin-adenine dinucleotide: L8 (≠ V9), G9 (= G10), G11 (= G12), P12 (≠ M13), A13 (= A14), N32 (≠ G36), S33 (≠ A37), E34 (= E38), R41 (= R45), P42 (≠ I46), F77 (≠ K81), A78 (≠ V82), S105 (≠ T109), G106 (= G110), L123 (≠ Y129), Y124 (≠ R130), L150 (= L156), G257 (= G278), D258 (≠ E279), G268 (= G289), L269 (= L290), I270 (≠ V291), A273 (≠ L294), K301 (= K323)
5jclA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
29% identity, 28% coverage: 54:283/812 of query aligns to 72:299/429 of 5jclA
- binding flavin-adenine dinucleotide: I93 (≠ V82), A119 (= A108), T120 (= T109), G121 (= G110), R144 (= R130), E145 (≠ D131), D295 (≠ E279)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G170 (= G154), Y171 (≠ L155), I172 (≠ L156), E175 (= E159), P192 (≠ V176), R199 (= R183), G256 (≠ A240), V257 (= V241), G258 (= G242)
Sites not aligning to the query:
- active site: 13, 45, 46, 61, 65, 70, 317, 425
- binding flavin-adenine dinucleotide: 10, 11, 12, 13, 14, 36, 37, 38, 45, 46, 50, 311, 312, 313, 316, 346
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 311, 312, 346
Query Sequence
>Dsui_1825 FitnessBrowser__PS:Dsui_1825
MNKPKLVLVGNGMAGVRTLEELLKIAPDHYDITVFGAEPHPNYNRILLSPVLAGEMTVPE
IVLNDLQWYADNGIKLHLNKKVTKVDRVRRQVVAEDGTVESYDRLLLATGSNPFMLPIPG
NDLPGVIAYRDIADTDAMIEAARTHRHAVVIGGGLLGLEAANGLKLRGMDVTVVHVGPWL
LERQLDEVAGRMLQQSLEERGLKFLLQKNTEALIAGESGRVAAIRFKDGMQIPADLVVMA
VGIRPNTALAESSGIHCNRGIVVSDTLQTYDPKIYAVGECVSHRGIAYGLVAPLFEQAKV
CANHLAGYGIGRYQGSVTSTKLKVTGIDLFSAGDFMGGSDTEDIVLHDPAGGVYKRLVLK
DNKLVGGVLYGDTADGSWYFQLLREGKDVSQIRDHLMFGQSNLGDTGHQGHNKAAAMADS
AEVCGCNGVTKGVIVKAIKEKGLFTLDEVRKHTKASASCGSCTGLVEQILASTVGGAYQA
ASSAEKPMCGCTEHSHGAVRQAIRERHLTSIPAVIEALAWKNPNGCEKCRPALNYYLIST
FPHEAMDDPQSRFINERAHANIQKDGTYSVVPRMWGGVTTPNELRAIADVADKYQVPMVK
VTGGQRIDLLGVKKEDLPHMWADLAQAGMVSGHAYGKSIRTVKTCVGSQFCRFGTQDSTG
MGIELEKMLFDMWSPHKVKLAVSGCPRNCAESGIKDVGIIAVDSGWEIHVAGNGGIKTEA
AQFLCKVATAEEVKEYSGAFLQLYREEGFYLERTVHYVQRVGLDHVKRLVVEDEDNRKAL
HARLLDSLKDAADPWAEHQEAPARREFEPLAF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory