Comparing Dsui_1826 FitnessBrowser__PS:Dsui_1826 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
27% identity, 98% coverage: 2:101/102 of query aligns to 1:100/102 of 5bokA
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
29% identity, 96% coverage: 3:100/102 of query aligns to 4:101/104 of P0A185
Sites not aligning to the query:
1sjgA Solution structure of t4moc, the rieske ferredoxin component of the toluene 4-monooxygenase complex (see paper)
25% identity, 98% coverage: 3:102/102 of query aligns to 2:102/112 of 1sjgA
Q00458 Toluene-4-monooxygenase system, ferredoxin component; T4MO; Toluene-4-monooxygenase system protein C; T4moC from Pseudomonas mendocina (see 4 papers)
25% identity, 98% coverage: 3:102/102 of query aligns to 2:102/112 of Q00458
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
29% identity, 96% coverage: 3:100/102 of query aligns to 3:100/103 of 2qpzA
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
32% identity, 98% coverage: 1:100/102 of query aligns to 1:102/107 of Q8GI16
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
31% identity, 95% coverage: 4:100/102 of query aligns to 4:101/114 of 4nbbE
1vm9A The x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1 (see paper)
24% identity, 98% coverage: 3:102/102 of query aligns to 1:101/109 of 1vm9A
6ickA Pseudomonas putida cbb5 ndma (see paper)
29% identity, 66% coverage: 35:101/102 of query aligns to 46:120/330 of 6ickA
Sites not aligning to the query:
6icqA Pseudomonas putida cbb5 ndma ql mutant with theobromine (see paper)
29% identity, 66% coverage: 35:101/102 of query aligns to 46:120/334 of 6icqA
Sites not aligning to the query:
6icoA Pseudomonas putida cbb5 ndma with theophylline (see paper)
29% identity, 66% coverage: 35:101/102 of query aligns to 46:120/344 of 6icoA
Sites not aligning to the query:
6icnA Pseudomonas putida cbb5 ndma with caffeine (see paper)
29% identity, 66% coverage: 35:101/102 of query aligns to 46:120/344 of 6icnA
Sites not aligning to the query:
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
29% identity, 97% coverage: 3:101/102 of query aligns to 2:101/109 of 1fqtA
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
33% identity, 79% coverage: 20:100/102 of query aligns to 19:99/102 of 2i7fA
4qdfB Crystal structure of apo ksha5 and ksha1 in complex with 1,4-30q-coa from r. Rhodochrous (see paper)
40% identity, 44% coverage: 25:69/102 of query aligns to 29:73/357 of 4qdfB
Sites not aligning to the query:
F1CMX0 3-ketosteroid-9-alpha-monooxygenase, oxygenase component; 3-ketosteroid-9-alpha-hydroxylase, oxygenase component; KSH; Androsta-1,4-diene-3,17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO; EC 1.14.15.30 from Rhodococcus rhodochrous (see paper)
40% identity, 44% coverage: 25:69/102 of query aligns to 48:92/394 of F1CMX0
Sites not aligning to the query:
6vshC Crystal structure of apo dicamba monooxygenase (see paper)
31% identity, 83% coverage: 16:100/102 of query aligns to 22:110/320 of 6vshC
3gobA Crystal structure of dicamba monooxygenase with non-heme cobalt and dcsa (see paper)
31% identity, 83% coverage: 16:100/102 of query aligns to 23:111/342 of 3gobA
Sites not aligning to the query:
3gb4A Crystal structure of dicamba monooxygenase with non-heme cobalt and dicamba (see paper)
31% identity, 83% coverage: 16:100/102 of query aligns to 22:110/341 of 3gb4A
Sites not aligning to the query:
Q5S3I3 Dicamba O-demethylase, oxygenase component; Dicamba monooxygenase; DMO; Three-component Rieske non-heme iron oxygenase system; EC 1.14.15.- from Stenotrophomonas maltophilia (Pseudomonas maltophilia) (Xanthomonas maltophilia) (see 3 papers)
31% identity, 83% coverage: 16:100/102 of query aligns to 22:110/339 of Q5S3I3
Sites not aligning to the query:
>Dsui_1826 FitnessBrowser__PS:Dsui_1826
MSQWKNLCALEDIPLLGSRVVQHPGGDIAVFRTDGDAVFALHDKCPHKGGPLSQGIVHGQ
RVTCPLHSWNIELASGEAVAPDQGCTARFQVKVEDGRVWLQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory