SitesBLAST
Comparing Dsui_1902 FitnessBrowser__PS:Dsui_1902 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1hyuA Crystal structure of intact ahpf (see paper)
67% identity, 99% coverage: 1:516/520 of query aligns to 1:518/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G220), P222 (= P221), A223 (= A222), E243 (= E242), G247 (= G246), Q248 (= Q247), N257 (= N256), S289 (≠ R288), A290 (= A289), T322 (= T320), G323 (= G321), W326 (= W324), C345 (= C343), D488 (= D486), K495 (= K493), Q496 (= Q494), I497 (= I495)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
66% identity, 99% coverage: 1:516/520 of query aligns to 1:518/521 of 4ykgA
- active site: C345 (= C343), C348 (= C346), D349 (= D347)
- binding flavin-adenine dinucleotide: G221 (= G220), P222 (= P221), A223 (= A222), G242 (≠ A241), E243 (= E242), G247 (= G246), Q248 (= Q247), T252 (= T251), N257 (= N256), S289 (≠ R288), A290 (= A289), T322 (= T320), G323 (= G321), C348 (= C346), G487 (= G485), D488 (= D486), Q496 (= Q494), I497 (= I495)
- binding nicotinamide-adenine-dinucleotide: I361 (= I359), G364 (= G362), S366 (= S364), E385 (= E383), F386 (= F384), I449 (= I447), M467 (≠ R465), P493 (= P491)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
66% identity, 99% coverage: 1:516/520 of query aligns to 1:518/521 of 4ykfA
- active site: C345 (= C343), C348 (= C346), D349 (= D347)
- binding flavin-adenine dinucleotide: G221 (= G220), P222 (= P221), A223 (= A222), G242 (≠ A241), E243 (= E242), G247 (= G246), Q248 (= Q247), N257 (= N256), A290 (= A289), T322 (= T320), G323 (= G321), C348 (= C346), N454 (= N452), D488 (= D486), Q496 (= Q494), I497 (= I495)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (= I359), G364 (= G362), N365 (= N363), S366 (= S364), E385 (= E383), F386 (= F384), K391 (≠ R389), I449 (= I447), M467 (≠ R465)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
66% identity, 99% coverage: 1:516/520 of query aligns to 1:518/521 of P35340
- K53 (≠ R53) modified: N6-acetyllysine
- K354 (= K352) modified: N6-acetyllysine
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
41% identity, 58% coverage: 212:514/520 of query aligns to 5:304/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V248), L47 (≠ G253), N50 (= N256), C133 (= C343), C136 (= C346), D137 (= D347)
- binding flavin-adenine dinucleotide: V10 (= V217), G11 (= G218), A15 (= A222), D34 (≠ A241), K35 (≠ E242), G40 (= G246), L41 (≠ Q247), T42 (≠ V248), A45 (≠ T251), P46 (≠ L252), N50 (= N256), V82 (≠ A289), T110 (= T320), G111 (= G321), S154 (= S364), Q241 (≠ N452), G275 (= G485), D276 (= D486), A283 (≠ K493), Q284 (= Q494), I285 (= I495)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
37% identity, 57% coverage: 209:505/520 of query aligns to 3:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G218), G14 (= G220), P15 (= P221), A16 (= A222), F34 (≠ V240), E35 (≠ A241), K36 (≠ E242), G41 (= G246), A42 (≠ Q247), V83 (≠ A291), T112 (= T320), G113 (= G321), G276 (= G485), D277 (= D486)
- binding nicotinamide-adenine-dinucleotide: G153 (= G361), G154 (= G362), S156 (= S364), Q175 (≠ E383), N176 (≠ F384), T181 (≠ R389), V238 (≠ I447)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
32% identity, 58% coverage: 211:513/520 of query aligns to 4:303/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G220), P14 (= P221), A15 (= A222), E34 (≠ A241), Q35 (≠ E242), G40 (= G246), Q41 (= Q247), T45 (= T251), N50 (= N256), V82 (≠ L292), T110 (= T320), G111 (= G321), Y114 (≠ W324), C136 (= C346), V242 (≠ N452), G275 (= G485), D276 (= D486), Q284 (= Q494), I285 (= I495)
4ccqA Crystal structure of the thioredoxin reductase from entamoeba histolytica with NADP (see paper)
35% identity, 58% coverage: 210:509/520 of query aligns to 2:306/313 of 4ccqA
- active site: C139 (= C343), C142 (= C346), D143 (= D347), D161 (≠ N363), E165 (= E367)
- binding flavin-adenine dinucleotide: I9 (≠ V217), G10 (= G218), S11 (≠ G219), G12 (= G220), P13 (= P221), A14 (= A222), Y32 (≠ A241), E33 (= E242), G34 (≠ R243), A37 (vs. gap), V40 (vs. gap), A41 (vs. gap), G44 (= G246), Q45 (= Q247), L46 (≠ V248), T49 (= T251), N54 (= N256), T86 (≠ A290), I87 (≠ A291), T116 (= T320), G117 (= G321), H247 (≠ L449), G282 (= G485), D283 (= D486), R290 (≠ K493), Q291 (= Q494), A292 (≠ I495), A295 (= A498)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G159 (= G361), G160 (= G362), D161 (≠ N363), A162 (≠ S364), E165 (= E367), H181 (≠ E383), R182 (≠ F384), R183 (≠ G385), R187 (= R389), I245 (= I447)
4a5lA Crystal structure of the thioredoxin reductase from entamoeba histolytica (see paper)
35% identity, 58% coverage: 210:509/520 of query aligns to 2:306/313 of 4a5lA
- active site: C139 (= C343), C142 (= C346), D143 (= D347), D161 (≠ N363), E165 (= E367)
- binding flavin-adenine dinucleotide: I9 (≠ V217), G10 (= G218), S11 (≠ G219), G12 (= G220), P13 (= P221), A14 (= A222), Y32 (≠ A241), E33 (= E242), G34 (≠ R243), A37 (vs. gap), V40 (vs. gap), A41 (vs. gap), G44 (= G246), Q45 (= Q247), L46 (≠ V248), T49 (= T251), I52 (= I254), N54 (= N256), T86 (≠ A290), I87 (≠ A291), T116 (= T320), G117 (= G321), H247 (≠ L449), G282 (= G485), D283 (= D486), R290 (≠ K493), Q291 (= Q494), A292 (≠ I495), A295 (= A498)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G159 (= G361), A162 (≠ S364), H181 (≠ E383), R182 (≠ F384), R183 (≠ G385), R187 (= R389), I245 (= I447)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
33% identity, 58% coverage: 210:513/520 of query aligns to 5:307/310 of 3f8pD
- active site: C135 (= C343), C138 (= C346), D139 (= D347)
- binding nicotinamide-adenine-dinucleotide: V12 (= V217), G13 (= G218), L14 (≠ G219), G15 (= G220), P16 (= P221), A17 (= A222), G36 (≠ A241), T38 (≠ R243), G41 (= G246), Q42 (= Q247), I82 (≠ A290), V83 (≠ A291), G111 (≠ S319), I112 (≠ T320), G113 (= G321), G277 (= G485), D278 (= D486)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
34% identity, 58% coverage: 209:509/520 of query aligns to 1:299/306 of 5uthA
- active site: C133 (= C343), C136 (= C346), D137 (= D347)
- binding flavin-adenine dinucleotide: I9 (≠ V217), G10 (= G218), S11 (≠ G219), G12 (= G220), P13 (= P221), A14 (= A222), F32 (≠ V240), E33 (vs. gap), G34 (≠ A241), Q36 (≠ R243), G39 (= G246), A40 (≠ Q247), L41 (≠ V248), N49 (= N256), D81 (≠ R288), V82 (≠ A289), M110 (≠ T320), G111 (= G321), C136 (= C346), G275 (= G485), D276 (= D486), R283 (≠ K493), Q284 (= Q494), A285 (≠ I495), A288 (= A498)
4a65A Crystal structure of the thioredoxin reductase from entamoeba histolytica with aucn (see paper)
35% identity, 58% coverage: 211:509/520 of query aligns to 1:304/311 of 4a65A
- active site: C137 (= C343), C140 (= C346), D141 (= D347), D159 (≠ N363), E163 (= E367)
- binding gold ion: G280 (= G485), C283 (≠ T488)
- binding flavin-adenine dinucleotide: I7 (≠ V217), G8 (= G218), S9 (≠ G219), G10 (= G220), P11 (= P221), A12 (= A222), Y30 (≠ A241), E31 (= E242), G32 (≠ R243), A35 (vs. gap), V38 (vs. gap), A39 (vs. gap), G42 (= G246), Q43 (= Q247), N52 (= N256), T84 (≠ A290), I85 (≠ A291), T114 (= T320), G115 (= G321), H245 (≠ L449), G280 (= G485), D281 (= D486), R288 (≠ K493), Q289 (= Q494), A290 (≠ I495), A293 (= A498)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G157 (= G361), G158 (= G362), A160 (≠ S364), H179 (≠ E383), R180 (≠ F384), R181 (≠ G385), R185 (= R389), I243 (= I447)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
34% identity, 58% coverage: 211:509/520 of query aligns to 2:298/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ V217), G9 (= G218), S10 (≠ G219), G11 (= G220), P12 (= P221), A13 (= A222), E32 (vs. gap), G33 (≠ A241), Q35 (≠ R243), G38 (= G246), A39 (≠ Q247), L40 (≠ V248), T43 (= T251), N48 (= N256), D80 (≠ R288), V81 (≠ A289), M109 (≠ T320), G110 (= G321), T131 (≠ Y342), C135 (= C346), G274 (= G485), D275 (= D486), R282 (≠ K493), Q283 (= Q494), A284 (≠ I495), A287 (= A498)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R325), H115 (≠ E326), L116 (≠ M327), R173 (≠ F384), E200 (≠ Q411), I201 (≠ T412), I235 (= I447)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
34% identity, 58% coverage: 211:509/520 of query aligns to 2:298/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ V217), G9 (= G218), S10 (≠ G219), G11 (= G220), P12 (= P221), A13 (= A222), E32 (vs. gap), G33 (≠ A241), Q35 (≠ R243), G38 (= G246), A39 (≠ Q247), L40 (≠ V248), T43 (= T251), N48 (= N256), D80 (≠ R288), V81 (≠ A289), M109 (≠ T320), G110 (= G321), T131 (≠ Y342), C135 (= C346), G274 (= G485), D275 (= D486), R282 (≠ K493), Q283 (= Q494), A284 (≠ I495), A287 (= A498)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (≠ M327), R173 (≠ F384), E200 (≠ Q411), I201 (≠ T412)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
34% identity, 58% coverage: 211:509/520 of query aligns to 2:298/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G218), S10 (≠ G219), G11 (= G220), P12 (= P221), A13 (= A222), E32 (vs. gap), G33 (≠ A241), Q35 (≠ R243), G38 (= G246), A39 (≠ Q247), L40 (≠ V248), T43 (= T251), N48 (= N256), D80 (≠ R288), V81 (≠ A289), M109 (≠ T320), G110 (= G321), T131 (≠ Y342), C135 (= C346), G274 (= G485), D275 (= D486), R282 (≠ K493), Q283 (= Q494), A284 (≠ I495), A287 (= A498)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R325), H115 (≠ E326), L116 (≠ M327), V148 (≠ I359), R173 (≠ F384), E200 (≠ Q411), I201 (≠ T412)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
34% identity, 58% coverage: 211:509/520 of query aligns to 2:298/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ V217), G9 (= G218), S10 (≠ G219), G11 (= G220), P12 (= P221), A13 (= A222), E32 (vs. gap), G33 (≠ A241), Q35 (≠ R243), G38 (= G246), A39 (≠ Q247), L40 (≠ V248), T43 (= T251), N48 (= N256), D80 (≠ R288), V81 (≠ A289), M109 (≠ T320), G110 (= G321), T131 (≠ Y342), C135 (= C346), G274 (= G485), D275 (= D486), R282 (≠ K493), Q283 (= Q494), A284 (≠ I495), A287 (= A498)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G361), G151 (= G362), D152 (≠ N363), S153 (= S364), E156 (= E367), H172 (≠ E383), R173 (≠ F384), R174 (≠ G385), R178 (= R389), I235 (= I447)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
33% identity, 58% coverage: 210:513/520 of query aligns to 5:305/308 of 3f8rA
- active site: C133 (= C343), C136 (= C346), D137 (= D347)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (= V217), G13 (= G218), L14 (≠ G219), G15 (= G220), P16 (= P221), A17 (= A222), E37 (= E242), T38 (≠ R243), G41 (= G246), Q42 (= Q247), I82 (= I283), V83 (≠ M284), G109 (≠ S319), I110 (≠ T320), G111 (= G321), R115 (= R325), L117 (≠ M327), D153 (≠ N363), S154 (= S364), E157 (= E367), R174 (≠ F384), R175 (≠ G385), Y184 (≠ L394), I236 (= I447), G275 (= G485), D276 (= D486), L282 (≠ V490), G283 (≠ P491), R285 (≠ K493)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
34% identity, 58% coverage: 206:509/520 of query aligns to 1:301/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G218), G15 (= G220), P16 (= P221), A17 (= A222), E36 (= E242), R37 (= R243), G42 (= G246), Q43 (= Q247), T47 (= T251), N52 (= N256), G82 (≠ A290), V84 (≠ L292), A111 (≠ S319), S112 (≠ T320), G113 (= G321), C138 (= C346), G277 (= G485), D278 (= D486), Q286 (= Q494), I287 (= I495)
- binding alpha-D-glucopyranose: R27 (= R232), D49 (≠ G253), K74 (≠ E278), F75 (≠ Y279), P122 (= P330), G123 (= G331), E126 (= E334), G129 (≠ T337), G131 (= G339), V132 (= V340), F143 (= F351), E206 (= E414), N208 (≠ T416)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
34% identity, 58% coverage: 209:509/520 of query aligns to 1:298/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G218), G12 (= G220), P13 (= P221), A14 (= A222), E33 (= E242), R34 (= R243), G39 (= G246), Q40 (= Q247), T44 (= T251), N49 (= N256), G79 (≠ A290), D80 (≠ A291), V81 (≠ L292), S109 (≠ T320), G110 (= G321), Y113 (≠ W324), C135 (= C346), G274 (= G485), D275 (= D486), Q283 (= Q494), I284 (= I495)
- binding alpha-D-glucopyranose: D46 (≠ G253), E48 (= E255), G126 (≠ T337), G128 (= G339), D136 (= D347), A138 (≠ P349), F139 (≠ L350), F139 (≠ L350), F140 (= F351)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G361), G151 (= G362), D152 (≠ N363), S153 (= S364), E156 (= E367), H172 (≠ E383), R173 (≠ F384), R174 (≠ G385), R178 (= R389), I236 (= I447)
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
33% identity, 58% coverage: 210:513/520 of query aligns to 5:305/308 of 3f8dA
- active site: C133 (= C343), A136 (≠ C346), D137 (= D347)
- binding flavin-adenine dinucleotide: V12 (= V217), G13 (= G218), L14 (≠ G219), G15 (= G220), P16 (= P221), A17 (= A222), G36 (≠ A241), E37 (= E242), T38 (≠ R243), G41 (= G246), Q42 (= Q247), E45 (≠ D250), A46 (≠ T251), V49 (≠ I254), D51 (≠ N256), I82 (= I283), V83 (≠ M284), G109 (≠ S319), I110 (≠ T320), G111 (= G321), C133 (= C343), A136 (≠ C346), G275 (= G485), D276 (= D486), R285 (≠ K493), Q286 (= Q494), V287 (≠ I495)
Query Sequence
>Dsui_1902 FitnessBrowser__PS:Dsui_1902
MLDSSIKTQLKAYLEKLVQPIELVASLDDSATAQEMRSLLADIAELSDKVSLREDGQAAR
RPSFGIARAGQSPRIHFAGIPMGHEFTSLVLALLQSGGHPPKVEAEVVEQIKGLDGKFSF
ETFISLSCHNCPDVVQALNTMAVLNPNVEAVMIDGGVFQQEVEERQIMGVPAIYLNGQAF
GSGRMELGEILAKVDTGAAARDAAKLSDKEVFDVLVVGGGPAGAAAAIYAARKGIRTGVV
AERFGGQVLDTLGIENFISVKETEGPKLAMALEQHVREYEVDIMNLQRAAALKPAANGQP
AEVTLANGAVLKSKTVILSTGARWREMNVPGEAEYRTKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGKEMRADAVLQKKLLSLPNVTVITEAQTTEVTGDGQ
KVNGLKYKDRVSGEEKTVALEGIFVQIGLLPNTDWLKGTVELSDRGEIVINAKGETSAEG
VFAAGDCTTVPYKQIIIAMGEGAKASLSAFDHLIRSSALA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory