SitesBLAST
Comparing Dsui_1925 FitnessBrowser__PS:Dsui_1925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
64% identity, 97% coverage: 19:570/572 of query aligns to 4:539/539 of 6lpiB
- active site: I27 (= I42), G29 (= G44), G30 (= G45), S31 (≠ A46), I32 (= I47), E53 (= E68), C76 (≠ S91), F115 (= F130), Q116 (= Q131), E117 (= E132), K165 (= K180), M256 (= M273), A283 (= A300), V375 (= V401), G401 (= G427), M403 (= M429), D428 (= D454), N455 (= N481), A457 (= A483), L458 (= L484), L460 (= L486), V461 (= V487), Q464 (= Q490)
- binding flavin-adenine dinucleotide: R155 (= R170), G212 (= G227), G213 (= G228), G214 (= G229), T236 (= T253), L237 (= L254), M238 (= M255), L254 (= L271), M256 (= M273), H257 (= H274), G276 (= G293), A277 (= A294), R278 (= R295), D280 (= D297), R282 (= R299), A283 (= A300), D300 (= D317), I301 (= I318), D319 (= D336), V320 (= V337), M380 (= M406), G398 (= G424)
- binding magnesium ion: D428 (= D454), N455 (= N481)
- binding thiamine diphosphate: E53 (= E68), C76 (≠ S91), P79 (= P94), G376 (= G402), Q377 (= Q403), H378 (= H404), G401 (= G427), M403 (= M429), G427 (= G453), D428 (= D454), G429 (= G455), S430 (= S456), M433 (= M459), N455 (= N481), A457 (= A483), L458 (= L484), G459 (= G485), L460 (= L486), V461 (= V487)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/583 of 5k3sA
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R299), M485 (≠ L486), W489 (≠ Q490), G569 (= G563)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), M266 (= M273), G286 (= G293), R288 (= R295), D290 (= D297), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), M405 (= M406), G423 (= G424)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V401), G401 (= G402), Q402 (= Q403), H403 (= H404), G426 (= G427), M428 (= M429), D453 (= D454), G454 (= G455), S455 (= S456), N480 (= N481), H482 (≠ A483), L483 (= L484), G484 (= G485), M485 (≠ L486), V486 (= V487)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/585 of 5k2oA
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M273), R292 (= R299), W489 (≠ Q490), S568 (≠ P562)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), G286 (= G293), R288 (= R295), D290 (= D297), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), Q404 (= Q405), M405 (= M406), G423 (= G424)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V401), G401 (= G402), Q402 (= Q403), H403 (= H404), M428 (= M429), D453 (= D454), G454 (= G455), S455 (= S456), N480 (= N481), H482 (≠ A483), L483 (= L484), G484 (= G485), M485 (≠ L486), V486 (= V487)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 13:575/582 of 3ea4A
- active site: Y32 (≠ I42), G34 (= G44), G35 (= G45), A36 (= A46), S37 (≠ I47), E58 (= E68), T81 (≠ S91), F120 (= F130), Q121 (= Q131), E122 (= E132), K170 (= K180), M265 (= M273), V292 (≠ A300), V399 (= V401), G425 (= G427), M427 (= M429), D452 (= D454), N479 (= N481), H481 (≠ A483), L482 (= L484), M484 (≠ L486), V485 (= V487), W488 (≠ Q490), H557 (≠ M552)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D298), R291 (= R299), W488 (≠ Q490), S567 (≠ P562)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R170), G221 (= G227), G222 (= G228), G223 (= G229), T245 (= T253), L246 (= L254), M247 (= M255), L263 (= L271), G264 (= G272), M265 (= M273), H266 (= H274), G285 (= G293), R287 (= R295), D289 (= D297), R291 (= R299), D309 (= D317), I310 (= I318), G327 (= G335), D328 (= D336), V329 (= V337), M404 (= M406), G422 (= G424)
- binding magnesium ion: D452 (= D454), N479 (= N481), H481 (≠ A483)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V401), G400 (= G402), Q401 (= Q403), H402 (= H404), M427 (= M429), G451 (= G453), D452 (= D454), G453 (= G455), S454 (= S456), N479 (= N481), H481 (≠ A483), L482 (= L484), G483 (= G485), M484 (≠ L486), V485 (= V487)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 13:575/582 of 3e9yA
- active site: Y32 (≠ I42), G34 (= G44), G35 (= G45), A36 (= A46), S37 (≠ I47), E58 (= E68), T81 (≠ S91), F120 (= F130), Q121 (= Q131), E122 (= E132), K170 (= K180), M265 (= M273), V292 (≠ A300), V399 (= V401), G425 (= G427), M427 (= M429), D452 (= D454), N479 (= N481), H481 (≠ A483), L482 (= L484), M484 (≠ L486), V485 (= V487), W488 (≠ Q490), H557 (≠ M552)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D298), R291 (= R299), W488 (≠ Q490), S567 (≠ P562)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R170), G221 (= G227), G222 (= G228), G223 (= G229), T245 (= T253), L246 (= L254), M247 (= M255), L263 (= L271), G285 (= G293), R287 (= R295), D289 (= D297), R291 (= R299), D309 (= D317), I310 (= I318), G327 (= G335), D328 (= D336), V329 (= V337), M404 (= M406), G422 (= G424)
- binding magnesium ion: D452 (= D454), N479 (= N481), H481 (≠ A483)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V401), G400 (= G402), Q401 (= Q403), H402 (= H404), M427 (= M429), G451 (= G453), G453 (= G455), S454 (= S456), N479 (= N481), H481 (≠ A483), L482 (= L484), G483 (= G485), M484 (≠ L486), V485 (= V487)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
45% identity, 96% coverage: 23:570/572 of query aligns to 99:661/670 of P17597
- A122 (= A46) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L48) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E68) binding
- S186 (= S110) binding
- P197 (= P121) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ S123) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q131) binding
- K220 (= K144) binding
- R246 (= R170) binding ; binding
- K256 (= K180) binding
- G308 (= G228) binding
- TL 331:332 (= TL 253:254) binding
- C340 (≠ V262) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 271:274) binding
- GVRFD 371:375 (≠ GARFD 293:297) binding
- DR 376:377 (= DR 298:299) binding
- DI 395:396 (= DI 317:318) binding
- DV 414:415 (= DV 336:337) binding
- QH 487:488 (= QH 403:404) binding
- GG 508:509 (= GG 424:425) binding
- GAM 511:513 (≠ GTM 427:429) binding
- D538 (= D454) binding
- DGS 538:540 (= DGS 454:456) binding
- N565 (= N481) binding
- NQHLGM 565:570 (≠ NDALGL 481:486) binding
- H567 (≠ A483) binding
- W574 (≠ Q490) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P562) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V401), G401 (= G402), Q402 (= Q403), H403 (= H404), G426 (= G427), M428 (= M429), G452 (= G453), D453 (= D454), G454 (= G455), S455 (= S456), M458 (= M459), N480 (= N481), H482 (≠ A483), L483 (= L484), G484 (= G485), M485 (≠ L486), V486 (= V487)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), M266 (= M273), H267 (= H274), G286 (= G293), V287 (≠ A294), R288 (= R295), D290 (= D297), R292 (= R299), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), M405 (= M406), G423 (= G424)
- binding magnesium ion: F370 (≠ R378), D453 (= D454), M458 (= M459), Q461 (= Q462), N480 (= N481), H482 (≠ A483), K533 (≠ A527)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M273), R292 (= R299), M485 (≠ L486), W489 (≠ Q490), S568 (≠ P562)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 5wj1A
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), M263 (= M270), L264 (= L271), G286 (= G293), R288 (= R295), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), M405 (= M406), G423 (= G424), G424 (= G425)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M273), D291 (= D298), R292 (= R299), M485 (≠ L486), W489 (≠ Q490), S568 (≠ P562)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V401), G401 (= G402), Q402 (= Q403), H403 (= H404), M428 (= M429), D453 (= D454), G454 (= G455), S455 (= S456), M458 (= M459), N480 (= N481), H482 (≠ A483), L483 (= L484), G484 (= G485), M485 (≠ L486), V486 (= V487)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 5k6tA
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H274), R292 (= R299), M485 (≠ L486), W489 (≠ Q490), S568 (≠ P562)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), G286 (= G293), R288 (= R295), D290 (= D297), R292 (= R299), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), Q404 (= Q405), M405 (= M406), G423 (= G424)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V401), G401 (= G402), Q402 (= Q403), H403 (= H404), G426 (= G427), M428 (= M429), G452 (= G453), G454 (= G455), S455 (= S456), N480 (= N481), H482 (≠ A483), L483 (= L484), G484 (= G485)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 5k6rA
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R299), W489 (≠ Q490), S568 (≠ P562)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), M266 (= M273), G286 (= G293), R288 (= R295), R292 (= R299), V293 (≠ A300), D310 (= D317), I311 (= I318), G328 (= G335), D329 (= D336), V330 (= V337), M405 (= M406), G423 (= G424)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V401), G401 (= G402), Q402 (= Q403), H403 (= H404), G426 (= G427), M428 (= M429), D453 (= D454), G454 (= G455), S455 (= S456), M458 (= M459), N480 (= N481), H482 (≠ A483), L483 (= L484), G484 (= G485), M485 (≠ L486), V486 (= V487)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 1z8nA
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K144), R161 (= R170), Y191 (≠ G197), R194 (≠ Q199), D291 (= D298), R292 (= R299), D312 (= D319), W489 (≠ Q490), G569 (= G563)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), G265 (= G272), M266 (= M273), H267 (= H274), G286 (= G293), V287 (≠ A294), R288 (= R295), D290 (= D297), R292 (= R299), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), M405 (= M406), G423 (= G424), G424 (= G425)
- binding magnesium ion: D453 (= D454), N480 (= N481)
- binding thiamine diphosphate: V400 (= V401), G401 (= G402), Q402 (= Q403), H403 (= H404), G426 (= G427), M428 (= M429), G452 (= G453), G454 (= G455), S455 (= S456), N480 (= N481), H482 (≠ A483), L483 (= L484), G484 (= G485), M485 (≠ L486), V486 (= V487)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 1yi1A
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D298), R292 (= R299), W489 (≠ Q490), S568 (≠ P562)
- binding flavin-adenine dinucleotide: R161 (= R170), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), M263 (= M270), L264 (= L271), G265 (= G272), M266 (= M273), H267 (= H274), G286 (= G293), V287 (≠ A294), R288 (= R295), D290 (= D297), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), M405 (= M406), G423 (= G424), G424 (= G425)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 1yi0A
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D298), R292 (= R299), W489 (≠ Q490), S568 (≠ P562)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), G265 (= G272), M266 (= M273), H267 (= H274), G286 (= G293), V287 (≠ A294), R288 (= R295), D290 (= D297), R292 (= R299), V293 (≠ A300), D310 (= D317), I311 (= I318), G328 (= G335), D329 (= D336), V330 (= V337), M405 (= M406), G423 (= G424), G424 (= G425)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 1yhzA
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D298), R292 (= R299), M485 (≠ L486), W489 (≠ Q490), S568 (≠ P562)
- binding flavin-adenine dinucleotide: R161 (= R170), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), M266 (= M273), H267 (= H274), G286 (= G293), V287 (≠ A294), R288 (= R295), D290 (= D297), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), Q404 (= Q405), M405 (= M406), G423 (= G424), G424 (= G425)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 1yhyA
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D298), R292 (= R299), V486 (= V487), W489 (≠ Q490), S568 (≠ P562)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), G265 (= G272), M266 (= M273), H267 (= H274), G286 (= G293), V287 (≠ A294), R288 (= R295), D290 (= D297), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), Q404 (= Q405), M405 (= M406), G423 (= G424), G424 (= G425)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 1ybhA
- active site: Y33 (≠ I42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E68), T82 (≠ S91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M273), V293 (≠ A300), V400 (= V401), G426 (= G427), M428 (= M429), D453 (= D454), N480 (= N481), H482 (≠ A483), L483 (= L484), M485 (≠ L486), V486 (= V487), W489 (≠ Q490), H558 (≠ M552)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M273), D291 (= D298), R292 (= R299), M485 (≠ L486), W489 (≠ Q490), S568 (≠ P562)
- binding flavin-adenine dinucleotide: R161 (= R170), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), L264 (= L271), M266 (= M273), H267 (= H274), G286 (= G293), V287 (≠ A294), R288 (= R295), D290 (= D297), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), Q404 (= Q405), M405 (= M406), G423 (= G424), G424 (= G425)
- binding magnesium ion: D453 (= D454), N480 (= N481), H482 (≠ A483)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
45% identity, 97% coverage: 19:570/572 of query aligns to 89:655/664 of P09114
- P191 (= P121) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ Q490) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
45% identity, 96% coverage: 23:570/572 of query aligns to 14:576/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M273), R292 (= R299), W489 (≠ Q490), S568 (≠ P562)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V401), G401 (= G402), Q402 (= Q403), H403 (= H404), G426 (= G427), M428 (= M429), G452 (= G453), D453 (= D454), G454 (= G455), S455 (= S456), L483 (= L484), G484 (= G485), M485 (≠ L486), V486 (= V487)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G227), G223 (= G228), G224 (= G229), T246 (= T253), L247 (= L254), M248 (= M255), M263 (= M270), L264 (= L271), M266 (= M273), H267 (= H274), G286 (= G293), R288 (= R295), V293 (≠ A300), D310 (= D317), I311 (= I318), D329 (= D336), V330 (= V337), M405 (= M406), G423 (= G424)
- binding magnesium ion: A37 (= A46), T82 (≠ S91), S83 (= S92), Q122 (= Q131), Y381 (vs. gap), D453 (= D454), M458 (= M459), Q461 (= Q462), N480 (= N481), H482 (≠ A483), K533 (≠ A527)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
45% identity, 97% coverage: 19:570/572 of query aligns to 92:658/667 of P09342
- C161 (= C88) modified: Disulfide link with 307
- P194 (= P121) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V230) modified: Disulfide link with 161
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
42% identity, 96% coverage: 21:570/572 of query aligns to 8:569/591 of 5wkcA
- active site: Y29 (≠ I42), G31 (= G44), G32 (= G45), A33 (= A46), I34 (= I47), E55 (= E68), T78 (≠ S91), F117 (= F130), Q118 (= Q131), E119 (= E132), K167 (= K180), R222 (≠ E237), M258 (= M273), V285 (≠ A300), V401 (= V401), L426 (= L426), G427 (= G427), M429 (= M429), D454 (= D454), N481 (= N481), E483 (≠ A483), Q484 (≠ L484), M486 (≠ L486), V487 (= V487), W490 (≠ Q490), L512 (≠ I513), G517 (= G518), L518 (≠ I519), K551 (≠ M552)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V401), G402 (= G402), Q403 (= Q403), H404 (= H404), G427 (= G427), M429 (= M429), G453 (= G453), D454 (= D454), A455 (≠ G455), S456 (= S456), M459 (= M459), N481 (= N481), E483 (≠ A483), Q484 (≠ L484), G485 (= G485), M486 (≠ L486), V487 (= V487)
- binding ethaneperoxoic acid: G32 (= G45), Q118 (= Q131)
- binding flavin-adenine dinucleotide: R157 (= R170), G211 (= G227), A212 (≠ G228), G213 (= G229), N216 (vs. gap), T238 (= T253), L239 (= L254), Q240 (≠ M255), L256 (= L271), M258 (= M273), G278 (= G293), A279 (= A294), R280 (= R295), R284 (= R299), V285 (≠ A300), E311 (≠ D317), V312 (≠ I318), N316 (≠ E322), D330 (= D336), A331 (vs. gap), M406 (= M406), G424 (= G424)
- binding magnesium ion: D454 (= D454), N481 (= N481), E483 (≠ A483)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G45), A33 (= A46), V107 (= V120), F117 (= F130), K167 (= K180), M258 (= M273), R284 (= R299), M486 (≠ L486), W490 (≠ Q490)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P43), E55 (= E68)
Query Sequence
>Dsui_1925 FitnessBrowser__PS:Dsui_1925
MNAPAPQAARQTDAAPAPETLTGAQIVVRLLERQGVTTVSGIPGGAILPFYDALSASEKI
RHVLARHEQGAGFIAQGMARASGQPAVCLASSGPGATNLLTAIADAKLDSIPLVAITGQV
PRSMIGTDAFQEVDTYGLSIPITKHNFLVNSAEELLEVIPRAFTLAASGRPGPVLVDIPK
DVQAQAIEVSQWPAPGGRQAPPAPDMAAIEKAAAMINAAERPILYLGGGVVHSGAAEAAV
ALAEKASLPTTMTLMALGAMPVDHPLSIHMLGMHGARYTNLLLEECDLLIAVGARFDDRA
TGKVAAFCPKAQIIHIDIDPSELDKIKNAHVGIAGDVGEVLEKLSPLVEAHLRKRWLTHM
GDLRSRFRLQRPNLEDPRSHYGLIQAVADCLDDSAAIATDVGQHQMWVAQAYPLRRPRQW
LTSGGLGTMGFGVPAALGAALAEPERTVVCFTGDGSILMNIQELATIAEAGANLKIVLMN
NDALGLVYQQQELFYGKRYFASKFAGQPDFLKIAEGFGIDTLDLDTAADPRAALRQALQR
PGPCLIHAFIDMNEKVYPMVPPGAANTDMIGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory