SitesBLAST
Comparing Dsui_1954 FitnessBrowser__PS:Dsui_1954 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16703 Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 from Escherichia coli (strain K12) (see paper)
62% identity, 98% coverage: 4:297/299 of query aligns to 3:292/303 of P16703
- N71 (= N76) binding
- S255 (= S260) binding
2bhtA Crystal structure of o-acetylserine sulfhydrylase b (see paper)
62% identity, 98% coverage: 4:297/299 of query aligns to 3:292/294 of 2bhtA
- active site: K41 (= K46), S69 (= S74), Q199 (= Q204), G203 (= G208), S255 (= S260), C280 (= C285)
- binding pyridoxal-5'-phosphate: K41 (= K46), N71 (= N76), M173 (= M178), G174 (= G179), T175 (= T180), T176 (= T181), T178 (= T183), G208 (= G213), S255 (= S260), C280 (= C285)
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
44% identity, 99% coverage: 1:297/299 of query aligns to 4:306/310 of 5xoqA
- binding : T72 (= T73), S73 (= S74), G74 (= G75), T76 (= T77), M123 (= M124), Q144 (= Q145), R218 (vs. gap), H219 (vs. gap), Q222 (≠ R215), G223 (≠ K216), A226 (≠ E219)
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 98% coverage: 5:297/299 of query aligns to 7:305/310 of P9WP55
- K44 (= K46) modified: N6-(pyridoxal phosphate)lysine
- N74 (= N76) binding
- GTGGT 178:182 (≠ GTTGT 179:183) binding
- S266 (= S260) binding
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
46% identity, 98% coverage: 5:297/299 of query aligns to 7:305/306 of 2q3dA
- active site: K44 (= K46), S266 (= S260), P293 (≠ C285)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-propionic acid: K44 (= K46), T71 (= T73), S72 (= S74), N74 (= N76), T75 (= T77), Q144 (= Q145), V177 (≠ M178), G178 (= G179), T179 (= T180), G180 (≠ T181), T182 (= T183), G222 (vs. gap), I223 (vs. gap), S266 (= S260), P293 (≠ C285), D294 (= D286)
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
45% identity, 96% coverage: 5:292/299 of query aligns to 7:300/300 of 3zeiA
- active site: K44 (= K46), S266 (= S260), P293 (≠ C285)
- binding 3-[(Z)-[(5Z)-5-[[2-(2-hydroxy-2-oxoethyloxy)phenyl]methylidene]-3-methyl-4-oxidanylidene-1,3-thiazolidin-2-ylidene]amino]benzoic acid: T71 (= T73), S72 (= S74), I126 (≠ R128), Q144 (= Q145), F145 (= F146), K215 (= K216), G222 (vs. gap), A225 (vs. gap), F227 (≠ Y221)
- binding pyridoxal-5'-phosphate: K44 (= K46), N74 (= N76), V177 (≠ M178), G178 (= G179), T179 (= T180), G180 (≠ T181), T182 (= T183), G222 (vs. gap), S266 (= S260), P293 (≠ C285), D294 (= D286)
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
45% identity, 96% coverage: 5:292/299 of query aligns to 7:300/300 of 2q3cA
- active site: K44 (= K46), S266 (= S260), P293 (≠ C285)
- binding : T71 (= T73), S72 (= S74), G73 (= G75), T75 (= T77), M122 (= M124), Q144 (= Q145), K215 (= K216), G222 (vs. gap), A225 (vs. gap)
3vbeC Crystal structure of beta-cyanoalanine synthase in soybean (see paper)
44% identity, 99% coverage: 3:297/299 of query aligns to 13:314/329 of 3vbeC
- active site: K52 (= K46), S81 (= S74), E212 (≠ Q204), S216 (≠ G208), S275 (= S260), P302 (≠ C285)
- binding pyridoxal-5'-phosphate: K52 (= K46), N83 (= N76), M184 (≠ S176), G187 (= G179), S188 (≠ T180), G189 (≠ T181), T191 (= T183), G231 (vs. gap), S275 (= S260), P302 (≠ C285)
4lmaA Crystal structure analysis of o-acetylserine sulfhydrylase cysk1 from microcystis aeruginosa 7806 (see paper)
47% identity, 97% coverage: 7:297/299 of query aligns to 9:308/318 of 4lmaA
3vc3A Crystal structure of beta-cyanoalanine synthase k95a mutant in soybean (see paper)
43% identity, 99% coverage: 3:297/299 of query aligns to 6:307/322 of 3vc3A
- active site: A45 (≠ K46), S268 (= S260), P295 (≠ C285)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-l-cysteine: T73 (= T73), S74 (= S74), N76 (= N76), M77 (≠ T77), Q146 (= Q145), M177 (≠ S176), G180 (= G179), S181 (≠ T180), G182 (≠ T181), T184 (= T183), G224 (vs. gap), S268 (= S260), P295 (≠ C285)
4aecA Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyasE C (see paper)
44% identity, 98% coverage: 4:297/299 of query aligns to 16:316/323 of 4aecA
- active site: K54 (= K46), S277 (= S260)
- binding pyridoxal-5'-phosphate: K54 (= K46), N85 (= N76), I188 (≠ M178), G189 (= G179), T190 (= T180), G191 (≠ T181), G192 (= G182), T193 (= T183), G233 (vs. gap), S277 (= S260), P304 (≠ C285)
2isqA Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase (see paper)
43% identity, 99% coverage: 3:299/299 of query aligns to 5:308/320 of 2isqA
- active site: K44 (= K46), S267 (= S260)
- binding pyridoxal-5'-phosphate: K44 (= K46), N75 (= N76), G177 (≠ S177), G179 (= G179), T180 (= T180), G181 (≠ T181), T183 (= T183), G223 (vs. gap), S267 (= S260), P294 (≠ C285)
- binding : T72 (= T73), S73 (= S74), G74 (= G75), T76 (= T77), G122 (= G123), M123 (= M124), K124 (≠ E125), G217 (≠ W217), P218 (= P218), H219 (≠ E219), Q222 (vs. gap), G223 (vs. gap)
P47998 Cysteine synthase 1; At.OAS.5-8; Beta-substituted Ala synthase 1;1; ARAth-Bsas1;1; CSase A; AtCS-A; Cys-3A; O-acetylserine (thiol)-lyase 1; OAS-TL A; O-acetylserine sulfhydrylase; Protein ONSET OF LEAF DEATH 3; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
43% identity, 99% coverage: 3:299/299 of query aligns to 7:310/322 of P47998
- K46 (= K46) modified: N6-(pyridoxal phosphate)lysine; mutation to A: No cysteine synthase activity.
- T74 (= T73) mutation to A: Strong reduction of cysteine synthase activity.; mutation to S: Reduction of cysteine synthase activity.
- S75 (= S74) mutation S->A,N,T: Strong reduction of cysteine synthase activity.
- N77 (= N76) binding ; mutation to A: Reduction of cysteine synthase activity.; mutation to D: Strong reduction of cysteine synthase activity.
- T78 (= T77) mutation T->A,S: Reduction of cysteine synthase activity.
- Q147 (= Q145) mutation Q->A,E: Strong reduction of cysteine synthase activity.
- H157 (= H155) mutation H->Q,N: Slight reduction of cysteine synthase activity.
- G162 (= G160) mutation to E: In old3-1; displays a early leaf death phenotype. Abolishes cysteine synthase activity.
- GTGGT 181:185 (≠ GTTGT 179:183) binding
- T182 (= T180) mutation T->A,S: Slight reduction of cysteine synthase activity.
- T185 (= T183) mutation T->A,S: Strong reduction of cysteine synthase activity.
- K217 (≠ R215) mutation to A: Impaired interaction with SAT1.
- H221 (≠ E219) mutation to A: Impaired interaction with SAT1.
- K222 (vs. gap) mutation to A: Impaired interaction with SAT1.
- S269 (= S260) binding ; mutation to A: Strong reduction of cysteine synthase activity.; mutation to T: Reduction of cysteine synthase activity.
4lmbA Crystal structure analysis of o-acetylserine sulfhydrylase cysk2 complexed with cystine from microcystis aeruginosa 7806 (see paper)
44% identity, 99% coverage: 3:297/299 of query aligns to 5:308/310 of 4lmbA
- active site: K46 (= K46), S269 (= S260)
- binding cysteine: K46 (= K46), T74 (= T73), S75 (= S74), N77 (= N76), T78 (= T77), M101 (≠ Q100), M125 (= M124), M125 (= M124), Q147 (= Q145), F148 (= F146), Q224 (vs. gap), G225 (vs. gap), G225 (vs. gap), I226 (vs. gap), A228 (vs. gap)
- binding pyridoxal-5'-phosphate: K46 (= K46), N77 (= N76), V180 (≠ M178), G181 (= G179), T182 (= T180), G183 (≠ T181), T185 (= T183), G225 (vs. gap), S269 (= S260), P296 (≠ C285)
Q9FS29 Bifunctional L-3-cyanoalanine synthase/cysteine synthase 2, mitochondrial; EC 2.5.1.47; EC 4.4.1.9 from Solanum tuberosum (Potato) (see paper)
42% identity, 98% coverage: 5:297/299 of query aligns to 32:331/347 of Q9FS29
- E157 (= E132) mutation E->N,Q: No effect on catalytic activities.
1z7yA Crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant (see paper)
43% identity, 99% coverage: 3:299/299 of query aligns to 5:308/320 of 1z7yA
- active site: A44 (≠ K46), S267 (= S260)
- binding n-[(3-hydroxy-2-methyl-5-{[(trihydroxyphosphoranyl)oxy]methyl}pyridin-4-yl)methylene]methionine: G74 (= G75), N75 (= N76), T76 (= T77), Q145 (= Q145), I178 (≠ M178), G179 (= G179), T180 (= T180), G181 (≠ T181), T183 (= T183), G223 (vs. gap), S267 (= S260), P294 (≠ C285), S295 (≠ D286)
7n2tA O-acetylserine sulfhydrylase from citrullus vulgaris in the internal aldimine state, with citrate bound (see paper)
44% identity, 99% coverage: 3:297/299 of query aligns to 5:306/309 of 7n2tA
P9WP53 O-phosphoserine sulfhydrylase; OPS sulfhydrylase; CysO-thiocarboxylate-dependent cysteine synthase; Cysteine synthase B; CSase B; O-phosphoserine-specific cysteine synthase; [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase; EC 2.5.1.113 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
42% identity, 99% coverage: 2:297/299 of query aligns to 4:306/323 of P9WP53
- N81 (= N76) binding
- R220 (= R215) mutation to A: 700-fold decrease in the rate of the first half-reaction using OPS. Affects neither the rate of the first half-reaction using OAS nor the rate of the second half-reaction using sulfide or CysO-COSH.
- S265 (= S260) binding
Sites not aligning to the query:
- 319:323 mutation Missing: Decreased lifetime of the alpha-aminoacrylate reaction intermediate, increased susceptibility to oxidation by oxidative agents such as hydrogen peroxide, and partial loss of selectivity towards CysO-COSH as sulfur donor.
3dwgA Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of mycobacterium tuberculosis (see paper)
42% identity, 99% coverage: 2:297/299 of query aligns to 6:308/325 of 3dwgA
- active site: K53 (= K46), S267 (= S260)
- binding pyridoxal-5'-phosphate: K53 (= K46), N83 (= N76), G186 (= G179), T187 (= T180), T188 (= T181), G189 (= G182), T190 (= T183), S267 (= S260), A296 (≠ C285), D297 (= D286)
8b9wA Cysteine synthase from trypanosoma theileri with plp bound (see paper)
41% identity, 98% coverage: 4:297/299 of query aligns to 12:311/329 of 8b9wA
Query Sequence
>Dsui_1954 FitnessBrowser__PS:Dsui_1954
MYKTLEDFVGNTPLVQLKRLPGEAIAQRGNVILAKLEGNNPAGSVKDRPALSMISHAEQR
GEIRPGDTLIEATSGNTGIALAMAAAMRGYRMILVMPENQSLERRQTMRAYGAELILTPR
DGGMELARDVAEKMCDEGKGIILDQFANPDNPLAHFEGTGPEIWRDTKGQVTHFVSSMGT
TGTIIGTSQFLKKKNPRIQIVGCQPEEGSQIPGIRKWPEAYLPKIYERSRVDRLEYVSQA
EAEDMTRRLAREEGLFAGISSGGALAVALRLARELENATIVTIVCDRGDRYLSTGVFPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory