Comparing Dsui_2061 FitnessBrowser__PS:Dsui_2061 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4rv5A The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4rv5A
Sites not aligning to the query:
4obbA The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid.
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4obbA
Sites not aligning to the query:
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4rdcA
Sites not aligning to the query:
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4qymA
Sites not aligning to the query:
4otzA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4otzA
Sites not aligning to the query:
4og2A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with leucine
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4og2A
Sites not aligning to the query:
4oatA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine.
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4oatA
Sites not aligning to the query:
4nv3A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with valine.
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4nv3A
Sites not aligning to the query:
4nqrA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with alanine
38% identity, 85% coverage: 25:351/384 of query aligns to 3:335/364 of 4nqrA
Sites not aligning to the query:
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
35% identity, 78% coverage: 25:324/384 of query aligns to 3:301/348 of 4gnrA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
29% identity, 84% coverage: 25:345/384 of query aligns to 2:315/350 of 3td9A
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
27% identity, 79% coverage: 24:325/384 of query aligns to 2:301/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
27% identity, 79% coverage: 24:325/384 of query aligns to 2:301/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
27% identity, 79% coverage: 24:325/384 of query aligns to 2:301/344 of 1z16A
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
26% identity, 72% coverage: 46:321/384 of query aligns to 20:287/335 of 4q6bA
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
26% identity, 72% coverage: 46:321/384 of query aligns to 20:288/336 of 4mlcA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
28% identity, 83% coverage: 23:342/384 of query aligns to 1:317/345 of 4n0qB
1uskA L-leucine-binding protein with leucine bound (see paper)
27% identity, 69% coverage: 24:288/384 of query aligns to 2:264/345 of 1uskA
Sites not aligning to the query:
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
27% identity, 69% coverage: 24:288/384 of query aligns to 2:264/345 of 1usiA
Sites not aligning to the query:
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
27% identity, 85% coverage: 24:349/384 of query aligns to 2:319/348 of 3ipcA
>Dsui_2061 FitnessBrowser__PS:Dsui_2061
MRFLPKSLVLVGALAAAGLAQAADIKIGVAAALTGGAAQYGVAIRNGFQLAADEINAKGG
VNGNKIQLVVEDEQGKKEEGINVFKKLIFQDKVLMVFGPTLSNSMFAAGPVANGAKTVVF
GTSVTANGITDIGPYVFRNSVMESDVLPVTVATATKHYKLKQVAVIYGNDDAFTKSGYDV
FKKVLEDQKLPVTTTETYVKGDVDFKAQLTKIKASNPDAVICSCLAEEAANIMLQARGLG
IKVPFIGGNGFNSPKLFEISKLAGEGTFVGSPWSNTNPAPANKAFVAAYVKKYNAEPNQF
AAQAFDALHVAAAALQEVKLSGDIAADREALKNALPKATINGATGPFKFRPAVTKSGKPG
GWDADQKPFIYVVKGGKFTAFDGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory