Comparing Dsui_2068 FitnessBrowser__PS:Dsui_2068 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
52% identity, 85% coverage: 11:247/278 of query aligns to 2:238/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
52% identity, 85% coverage: 11:247/278 of query aligns to 3:239/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
52% identity, 85% coverage: 11:247/278 of query aligns to 3:239/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
52% identity, 85% coverage: 11:247/278 of query aligns to 3:239/344 of 6cvlD
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
46% identity, 75% coverage: 21:229/278 of query aligns to 10:216/222 of 8i6rB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
47% identity, 80% coverage: 9:230/278 of query aligns to 1:216/241 of 4u00A
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
44% identity, 77% coverage: 16:228/278 of query aligns to 7:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
44% identity, 77% coverage: 16:228/278 of query aligns to 7:215/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
43% identity, 77% coverage: 16:228/278 of query aligns to 7:215/218 of 8hd0A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
45% identity, 72% coverage: 35:233/278 of query aligns to 22:219/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
42% identity, 71% coverage: 34:230/278 of query aligns to 23:218/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
42% identity, 71% coverage: 34:230/278 of query aligns to 23:218/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
42% identity, 71% coverage: 34:230/278 of query aligns to 23:218/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
42% identity, 71% coverage: 34:230/278 of query aligns to 23:218/242 of 2oljA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 74% coverage: 25:230/278 of query aligns to 37:243/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 74% coverage: 25:230/278 of query aligns to 37:243/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
38% identity, 74% coverage: 25:230/278 of query aligns to 37:243/260 of 7ahdC
Sites not aligning to the query:
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
42% identity, 71% coverage: 16:213/278 of query aligns to 8:201/220 of 8tzjA
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
37% identity, 82% coverage: 2:229/278 of query aligns to 9:218/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
37% identity, 82% coverage: 2:229/278 of query aligns to 9:218/229 of 6z67B
>Dsui_2068 FitnessBrowser__PS:Dsui_2068
MTTQNTDSPALALRGVSKSFRTPDGQQVGVHPTDLDVAPGEIHGIIGFSGAGKSTLLRLA
NLLERPDAGQVVVHGQDLMTLSPADLRTARQRIGMIFQHFNLLHNRTVADNVAFPLRIAG
ADEARINERVKTCLEFVGLSEKAGVYPAQLSGGQKQRVAIARALAPEPHVLLADEPTSAL
DPRTTQSLLEVLADVNRRLGVTILLVSHEMGVIRRLCHRVSVMEAGQIVERLTIANGRIP
PDSQLAQWLREYGDAEGDAEEAAADPAPQHLLSEAAHG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory