SitesBLAST
Comparing Dsui_2089 FitnessBrowser__PS:Dsui_2089 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
37% identity, 99% coverage: 3:251/251 of query aligns to 8:255/255 of 3iccA
- active site: G18 (= G13), S148 (≠ T143), F158 (≠ Y153), Y161 (= Y156), K165 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G9), S16 (= S11), R17 (= R12), G18 (= G13), I19 (≠ L14), H37 (≠ T32), Y38 (= Y33), G39 (≠ R34), L66 (≠ V61), E67 (≠ D62), N98 (= N93), G100 (= G95), I146 (≠ V141), S148 (≠ T143), Y161 (= Y156), K165 (= K160), P191 (= P186), G192 (= G187), M198 (≠ F193), N199 (≠ G194)
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
40% identity, 99% coverage: 3:251/251 of query aligns to 7:250/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), S15 (= S11), R16 (= R12), G17 (= G13), I18 (≠ L14), H36 (≠ T32), Y37 (= Y33), G38 (≠ R34), H39 (≠ S35), L65 (= L59), N97 (= N93), G99 (= G95), S147 (≠ T143), Y160 (= Y156), K164 (= K160), G191 (= G187), T193 (≠ I189), T195 (= T191)
4ospA The crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound NADP and rabelomycin (see paper)
40% identity, 99% coverage: 3:251/251 of query aligns to 6:251/252 of 4ospA
- active site: G16 (= G13), S146 (≠ T143), Y159 (= Y156), K163 (= K160)
- binding rabelomycin: M100 (≠ G97), S146 (≠ T143), G147 (= G144), L148 (= L145), F151 (= F148), I191 (≠ A188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), R15 (= R12), G16 (= G13), I17 (≠ L14), H35 (≠ Y33), C36 (≠ R34), S37 (= S35), E63 (≠ A60), L64 (≠ V61), N96 (= N93), V99 (≠ M96), R115 (≠ L112), I144 (≠ V141), S146 (≠ T143), Y159 (= Y156), K163 (= K160), P189 (= P186), T192 (≠ I189), N194 (≠ T191)
6ypzAAA Monooxygenase (see paper)
38% identity, 99% coverage: 3:251/251 of query aligns to 6:253/253 of 6ypzAAA
- active site: G16 (= G13), S148 (≠ T143), Y161 (= Y156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), G16 (= G13), I17 (≠ L14), H35 (≠ T32), A37 (≠ R34), S38 (= S35), N39 (≠ R36), L64 (≠ V61), N96 (= N93), A97 (= A94), A98 (≠ G95), T100 (vs. gap), I146 (≠ V141), S147 (= S142), S148 (≠ T143), Y161 (= Y156), K165 (= K160), P191 (= P186), G192 (= G187), I193 (≠ A188), T194 (≠ I189), N196 (≠ T191)
6yq0AAA Monooxygenase (see paper)
38% identity, 99% coverage: 3:251/251 of query aligns to 6:253/254 of 6yq0AAA
- active site: G16 (= G13), S148 (≠ T143), Y161 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), G16 (= G13), I17 (≠ L14), H35 (≠ T32), A37 (≠ R34), S38 (= S35), N39 (≠ R36), L64 (≠ V61), N96 (= N93), A97 (= A94), A98 (≠ G95), T100 (vs. gap), R117 (≠ L112), I146 (≠ V141), S147 (= S142), S148 (≠ T143), Y161 (= Y156), K165 (= K160), P191 (= P186), G192 (= G187), I193 (≠ A188), T194 (≠ I189), N196 (≠ T191)
- binding (3~{R})-8-methoxy-3-methyl-3-oxidanyl-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: T100 (vs. gap), G101 (= G97), S148 (≠ T143), G149 (= G144), L150 (= L145), C153 (≠ F148), Q158 (≠ Y153), Y161 (= Y156), G192 (= G187), I193 (≠ A188), T251 (≠ M249)
6yq3AAA Monooxygenase (see paper)
38% identity, 99% coverage: 3:251/251 of query aligns to 6:251/252 of 6yq3AAA
- active site: G16 (= G13), S146 (≠ T143), Y159 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), G16 (= G13), I17 (≠ L14), H35 (≠ T32), A37 (≠ R34), S38 (= S35), N39 (≠ R36), L64 (≠ V61), N96 (= N93), A97 (= A94), A98 (≠ G95), V119 (≠ T116), I144 (≠ V141), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), I191 (≠ A188), T192 (≠ I189), N194 (≠ T191)
- binding (3~{R})-8-methoxy-3-methyl-3,6-bis(oxidanyl)-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: S146 (≠ T143), G147 (= G144), L148 (= L145), Q156 (≠ Y153), Y159 (= Y156), I191 (≠ A188), T249 (≠ M249)
4kwhB The crystal structure of angucyclinE C-6 ketoreductase lanv with bound NADP (see paper)
37% identity, 99% coverage: 3:251/251 of query aligns to 11:256/257 of 4kwhB
- active site: G21 (= G13), S151 (≠ T143), Y164 (= Y156), K168 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G9), S19 (= S11), R20 (= R12), G21 (= G13), I22 (≠ L14), H40 (≠ T32), A42 (≠ R34), T43 (≠ S35), G44 (≠ R36), E68 (≠ A60), L69 (≠ V61), N101 (= N93), M105 (≠ G97), Y164 (= Y156), K168 (= K160), P194 (= P186), S196 (≠ A188), T197 (≠ I189), N199 (≠ T191)
4osoA The crystal structure of landomycin c-6 ketoreductase lanv with bound NADP and rabelomycin (see paper)
37% identity, 99% coverage: 3:251/251 of query aligns to 6:251/252 of 4osoA
- active site: G16 (= G13), S146 (≠ T143), Y159 (= Y156), K163 (= K160)
- binding rabelomycin: M100 (≠ G97), S146 (≠ T143), G147 (= G144), L148 (= L145), Y159 (= Y156), G190 (= G187), L211 (≠ Q211), T249 (≠ M249)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), I17 (≠ L14), H35 (≠ T32), Y36 (= Y33), A37 (≠ R34), T38 (≠ S35), G39 (≠ R36), L64 (≠ V61), N96 (= N93), A97 (= A94), G98 (= G95), M100 (≠ G97), V144 (= V141), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), T192 (≠ I189), N194 (≠ T191)
4kwiA The crystal structure of angucyclinE C-6 ketoreductase lanv with bound NADP and 11-deoxy-6-oxylandomycinone (see paper)
37% identity, 99% coverage: 3:251/251 of query aligns to 6:251/252 of 4kwiA
- active site: G16 (= G13), S146 (≠ T143), Y159 (= Y156), K163 (= K160)
- binding 1,8-dihydroxy-3-methyltetraphene-6,7,12(5H)-trione: M100 (≠ G97), G147 (= G144), L148 (= L145), V151 (≠ F148), Q156 (≠ Y153), G190 (= G187), L198 (≠ V198), L208 (≠ I208), L211 (≠ Q211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), G16 (= G13), I17 (≠ L14), H35 (≠ T32), A37 (≠ R34), T38 (≠ S35), L64 (≠ V61), N96 (= N93), Y159 (= Y156), K163 (= K160), P189 (= P186), T192 (≠ I189), N194 (≠ T191)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 100% coverage: 1:251/251 of query aligns to 3:246/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 100% coverage: 2:251/251 of query aligns to 1:239/239 of 3sj7A
- active site: G12 (= G13), S138 (≠ T143), Q148 (≠ Y153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), S10 (= S11), R11 (= R12), I13 (≠ L14), N31 (≠ T32), Y32 (= Y33), A33 (≠ R34), G34 (≠ S35), S35 (≠ R36), A58 (≠ L59), N59 (≠ A60), V60 (= V61), N86 (= N93), A87 (= A94), T109 (= T116), S138 (≠ T143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
35% identity, 98% coverage: 3:249/251 of query aligns to 12:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G9), S20 (= S11), K21 (≠ R12), G22 (= G13), I23 (≠ L14), A43 (≠ R34), S44 (= S35), S45 (≠ R36), G68 (≠ L59), D69 (≠ A60), V70 (= V61), N96 (= N93), S97 (≠ A94), G98 (= G95), Y100 (≠ G97), I144 (≠ V141), S146 (≠ T143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (= G187), M191 (≠ A188), I192 (= I189), T194 (= T191), G196 (≠ F193), T197 (≠ G194)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (≠ T143), Y159 (= Y156), M191 (≠ A188), I202 (≠ R199)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
33% identity, 99% coverage: 3:251/251 of query aligns to 6:243/244 of 6wprA
- active site: G16 (= G13), S138 (≠ T143), Y151 (= Y156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), T37 (≠ R34), L58 (= L59), D59 (≠ A60), V60 (= V61), N86 (= N93), A87 (= A94), G88 (= G95), I89 (≠ M96), I136 (≠ V141), Y151 (= Y156), K155 (= K160), P181 (= P186)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
33% identity, 99% coverage: 3:251/251 of query aligns to 6:243/244 of 6t62A
- active site: G16 (= G13), S138 (≠ T143), Y151 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), A36 (≠ Y33), T37 (≠ R34), L58 (= L59), D59 (≠ A60), V60 (= V61), N86 (= N93), A87 (= A94), G88 (= G95), I89 (≠ M96), I136 (≠ V141), S137 (= S142), S138 (≠ T143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), I184 (= I189), M188 (≠ F193)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 99% coverage: 3:251/251 of query aligns to 6:247/247 of 4jroC
- active site: G16 (= G13), S142 (≠ T143), Q152 (≠ Y153), Y155 (= Y156), K159 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (= S11), R15 (= R12), G16 (= G13), I17 (≠ L14), N35 (≠ T32), Y36 (= Y33), N37 (≠ R34), G38 (≠ S35), S39 (≠ R36), N63 (≠ A54), V64 (= V55), N90 (= N93), A91 (= A94), I93 (≠ M96), I113 (≠ T116), S142 (≠ T143), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (= I189), T190 (= T191)
1ja9A Crystal structure of 1,3,6,8-tetrahydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
33% identity, 98% coverage: 3:248/251 of query aligns to 7:257/259 of 1ja9A
- active site: G17 (= G13), S141 (= S142), H152 (≠ Y153), Y155 (= Y156), K159 (= K160), D194 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), R16 (= R12), G17 (= G13), I18 (≠ L14), G38 (≠ R34), S39 (= S35), S40 (≠ R36), A63 (≠ L59), I65 (≠ V61), N91 (= N93), S92 (≠ A94), G93 (= G95), L114 (≠ T116), T139 (≠ N140), S141 (= S142), Y155 (= Y156), K159 (= K160), P185 (= P186), G187 (≠ A188), V188 (≠ I189), T190 (= T191), M192 (≠ F193)
- binding pyroquilon: S141 (= S142), I142 (≠ T143), Y155 (= Y156), G187 (≠ A188), F193 (vs. gap), S197 (vs. gap), Y200 (vs. gap)
Sites not aligning to the query:
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
29% identity, 98% coverage: 3:249/251 of query aligns to 8:250/261 of 1g6kA
- active site: G18 (= G13), S145 (≠ T143), Y158 (= Y156), K162 (= K160)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ R12), G18 (= G13), L19 (= L14), R39 (= R34), D65 (≠ A60), V66 (= V61), N92 (= N93), A93 (= A94), G94 (= G95), M143 (≠ V141), S145 (≠ T143), Y158 (= Y156), P188 (= P186), G189 (= G187), I191 (= I189), T193 (= T191)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
32% identity, 99% coverage: 3:251/251 of query aligns to 17:270/270 of 1ybvA
- active site: G27 (= G13), S151 (vs. gap), H162 (≠ Y153), Y165 (= Y156), K169 (= K160), Y210 (vs. gap)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (vs. gap), Y165 (= Y156), G197 (≠ A188), M202 (≠ F193), Y203 (≠ G194), Y210 (vs. gap), W230 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G9), R26 (= R12), G27 (= G13), I28 (≠ L14), A48 (≠ R34), N49 (≠ S35), S50 (≠ R36), N74 (≠ A60), V75 (= V61), N101 (= N93), S102 (≠ A94), G103 (= G95), M149 (≠ V141), S151 (vs. gap), K169 (= K160), P195 (= P186), G197 (≠ A188), I198 (= I189), T200 (= T191), M202 (≠ F193)
1g0oC Structure of trihydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
32% identity, 99% coverage: 3:251/251 of query aligns to 28:281/281 of 1g0oC
- active site: G38 (= G13), S162 (vs. gap), H173 (≠ Y153), Y176 (= Y156), K180 (= K160), Y221 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G34 (= G9), R37 (= R12), G38 (= G13), I39 (≠ L14), A59 (≠ R34), N60 (≠ S35), S61 (≠ R36), N85 (≠ A60), V86 (= V61), N112 (= N93), S113 (≠ A94), G114 (= G95), M160 (≠ V141), Y176 (= Y156), K180 (= K160), P206 (= P186), G208 (≠ A188), I209 (= I189), T211 (= T191), M213 (≠ F193)
- binding pyroquilon: S162 (vs. gap), I163 (vs. gap), Y176 (= Y156), G208 (≠ A188), Y221 (vs. gap)
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
32% identity, 99% coverage: 3:251/251 of query aligns to 20:273/273 of 1g0nA
- active site: G30 (= G13), S154 (vs. gap), H165 (≠ Y153), Y168 (= Y156), K172 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G9), R29 (= R12), G30 (= G13), I31 (≠ L14), A51 (≠ R34), N52 (≠ S35), S53 (≠ R36), V78 (= V61), N104 (= N93), S105 (≠ A94), G106 (= G95), I127 (≠ T116), M152 (≠ V141), Y168 (= Y156), K172 (= K160), P198 (= P186), G200 (≠ A188), I201 (= I189), T203 (= T191), M205 (≠ F193)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (vs. gap), Y168 (= Y156), G200 (≠ A188), M205 (≠ F193), Y206 (≠ G194), C210 (≠ V198), Y213 (vs. gap), W233 (vs. gap)
Query Sequence
>Dsui_2089 FitnessBrowser__PS:Dsui_2089
MTKIALITGGSRGLGRNAALKLAARGVDIILTYRSRADEAAAVVAQIEALGRRAVALPLA
VDEAAGFPAFAEAVRQALAGTWQRERFDFLVNNAGMGINAAFAETTEAQFDLLMNTHLKG
PFFLTQALLPLLNDGGRILNVSTGLARFALPGYAAYASMKGGIEVLTRYLAKELGPRGIA
VNVLAPGAIETDFGGGAVRDNAQLNAFIAAQTALGRVGQPDDIGHAVAALLSEETGWITA
QRIEASGGMFL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory