Comparing Dsui_2103 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
6wnmA The structure of pf4r from a superinfective isolate of the filamentous phage pf4 of pseudomonas aeruginosa pa01 (see paper)
31% identity, 58% coverage: 27:77/88 of query aligns to 29:79/79 of 6wnmA
Sites not aligning to the query:
>Dsui_2103
MVVAAKTNPLRKYKELEEMTGINATSWRDVCLERKRATAEHLEAIGRLWPEYSLWLLTGR
TQSESGQTSPELEQLKLLQENLGKRSAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory