Comparing Dsui_2113 FitnessBrowser__PS:Dsui_2113 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
40% identity, 78% coverage: 52:309/332 of query aligns to 27:266/267 of 3q1xA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
40% identity, 78% coverage: 52:309/332 of query aligns to 29:268/270 of 3p47A
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
39% identity, 76% coverage: 52:303/332 of query aligns to 27:252/280 of 7bw9A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
42% identity, 50% coverage: 139:305/332 of query aligns to 74:231/243 of 4n69A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
36% identity, 56% coverage: 140:325/332 of query aligns to 77:253/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
38% identity, 50% coverage: 140:305/332 of query aligns to 75:231/243 of 7ra4A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
37% identity, 55% coverage: 130:312/332 of query aligns to 66:237/262 of 1t3dA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
37% identity, 55% coverage: 130:312/332 of query aligns to 62:233/258 of 8i04A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
37% identity, 55% coverage: 130:312/332 of query aligns to 66:237/244 of 8i06A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
37% identity, 55% coverage: 130:312/332 of query aligns to 65:236/246 of 8i09A
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
38% identity, 52% coverage: 133:304/332 of query aligns to 69:231/250 of 4hzdA
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
41% identity, 50% coverage: 139:305/332 of query aligns to 70:221/233 of 4n6bA
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
38% identity, 54% coverage: 130:309/332 of query aligns to 63:232/258 of 4h7oA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
38% identity, 50% coverage: 148:312/332 of query aligns to 87:240/272 of 3gvdI
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
36% identity, 53% coverage: 130:304/332 of query aligns to 62:227/257 of 1ssqD
1sstA Serine acetyltransferase- complex with coa (see paper)
34% identity, 53% coverage: 130:304/332 of query aligns to 62:220/233 of 1sstA
Sites not aligning to the query:
>Dsui_2113 FitnessBrowser__PS:Dsui_2113
MAAPTYGCGQSQGPQGQRPGAKWDLGRIVAELRAERERWRERQQRQKDVGGRELPSREVL
QEIVAALQGALFPMRLGPAQLHQESEDYYIGYTLDAALESLLGQVRLELCYAARHHATSD
GVVEERALHIVRSFAEALPQVRALLDTDVEAAYSGDPAARSVDEVLLCYPGVVAMIHHRL
AHQLYHLGVPLLARIVAELAHAETGIDIHPGASIGAGFFIDHGTGVVIGETAVIGQRVRL
YQAVTLGAKRFTTDEAGNLEKGQPRHPIVEDDVVIYAGATILGRITIGKGSSIGGNVWLT
HSVPPGSHVTQADSQHSQHSLPPPTPLKAAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory