Comparing Dsui_2121 FitnessBrowser__PS:Dsui_2121 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
42% identity, 69% coverage: 33:217/269 of query aligns to 47:236/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
42% identity, 69% coverage: 33:217/269 of query aligns to 47:236/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
40% identity, 72% coverage: 33:225/269 of query aligns to 47:242/260 of 7ahdC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 87% coverage: 12:244/269 of query aligns to 2:237/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
40% identity, 83% coverage: 27:248/269 of query aligns to 17:241/241 of 4u00A
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 88% coverage: 12:248/269 of query aligns to 4:241/393 of P9WQI3
1g291 Malk (see paper)
36% identity, 91% coverage: 11:256/269 of query aligns to 3:254/372 of 1g291
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 88% coverage: 23:259/269 of query aligns to 28:263/378 of P69874
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 86% coverage: 26:256/269 of query aligns to 20:257/375 of 2d62A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 77% coverage: 12:217/269 of query aligns to 2:218/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
37% identity, 77% coverage: 12:217/269 of query aligns to 2:218/230 of 1l2tA
3c4jA Abc protein artp in complex with atp-gamma-s
36% identity, 82% coverage: 27:247/269 of query aligns to 18:242/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
36% identity, 82% coverage: 27:247/269 of query aligns to 18:242/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
36% identity, 82% coverage: 27:247/269 of query aligns to 18:242/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
36% identity, 82% coverage: 27:247/269 of query aligns to 18:242/242 of 2oljA
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
35% identity, 92% coverage: 12:258/269 of query aligns to 3:253/363 of 8hprC
8hprD Lpqy-sugabc in state 4 (see paper)
35% identity, 92% coverage: 12:258/269 of query aligns to 3:253/362 of 8hprD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
35% identity, 76% coverage: 12:216/269 of query aligns to 4:215/226 of 5xu1B
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
37% identity, 83% coverage: 12:233/269 of query aligns to 7:215/353 of 1vciA
8hplC Lpqy-sugabc in state 1 (see paper)
35% identity, 92% coverage: 12:258/269 of query aligns to 3:251/384 of 8hplC
>Dsui_2121 FitnessBrowser__PS:Dsui_2121
MSNAAQTSATGLAVDNVSFAYGEGDTILRRVALEVPEGQFLTLLGPSGSGKSTLLRLIAG
LEAPTDGRLAWQGATITGPGIDRAVVFQNYSLFPWLKVEDNVALAVAKAHPKLSRAERRE
KARDYLGRVGLADAAGKYPFQLSGGMQQRAAIARALALEAPVLLMDEPFGALDPINRGKL
QDLLLEVWQSTSPRRTIVFVTHDVDEALYLGDRVAVLGASPGRVLAQIEVPFERPRNRAR
LFASPAFHALREDIAERLDADVLSGLAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory