Comparing Dsui_2189 FitnessBrowser__PS:Dsui_2189 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZMX2 Peptidyl-lysine N-acetyltransferase Pat; Protein lysine acetyltransferase; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 97% coverage: 8:878/896 of query aligns to 6:865/886 of Q8ZMX2
P76594 Peptidyl-lysine N-acetyltransferase PatZ; Protein lysine acetyltransferase; EC 2.3.1.- from Escherichia coli (strain K12) (see paper)
38% identity, 97% coverage: 8:878/896 of query aligns to 6:865/886 of P76594
5hbrA Ca. Korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with phosphate and coenzyme a (see paper)
37% identity, 51% coverage: 8:462/896 of query aligns to 4:460/464 of 5hbrA
4y8vA Ca. Korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and additional adp bound to phosphate binding site (see paper)
37% identity, 51% coverage: 8:462/896 of query aligns to 4:460/464 of 4y8vA
4yakC Ca. Korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, acetyl-coenzyme a and with phosphorylated phosphohistidine segment (site i orientation) (see paper)
37% identity, 51% coverage: 8:462/896 of query aligns to 3:459/463 of 4yakC
4xz3A Ca. Korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (se-met derivative) in complex with coenzyme a and mg- amppcp, phosphohistidine segment pointing towards nucleotide binding site (see paper)
37% identity, 51% coverage: 8:462/896 of query aligns to 3:459/463 of 4xz3A
7cm9A Dmsp lyase dddx (see paper)
27% identity, 77% coverage: 15:700/896 of query aligns to 15:687/693 of 7cm9A
4y8vB Ca. Korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with adp and additional adp bound to phosphate binding site (see paper)
39% identity, 24% coverage: 489:705/896 of query aligns to 14:228/229 of 4y8vB
4xz3B Ca. Korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 (se-met derivative) in complex with coenzyme a and mg- amppcp, phosphohistidine segment pointing towards nucleotide binding site (see paper)
39% identity, 24% coverage: 489:705/896 of query aligns to 13:227/228 of 4xz3B
4xymB Ca. Korarchaeum cryptofilum dinucleotide forming acetyl-coenzyme a synthetase 1 in complex with coenzyme a, ca-ampcp and hgcl+ (see paper)
39% identity, 24% coverage: 489:705/896 of query aligns to 14:228/229 of 4xymB
A0R3F9 Acetyltransferase Pat; GCN5-related N-acetyltransferase; GNAT; Protein acetyltransferase; Pat; EC 2.3.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 16% coverage: 736:875/896 of query aligns to 150:287/333 of A0R3F9
Sites not aligning to the query:
4avbA Crystal structure of protein lysine acetyltransferase rv0998 in complex with acetyl coa and camp (see paper)
31% identity, 16% coverage: 733:875/896 of query aligns to 142:280/324 of 4avbA
Sites not aligning to the query:
O05581 Acetyltransferase Pat; GCN5-like enzyme; GCN5-related N-acetyltransferase; GNAT; Protein acetyltransferase; Pat; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 16% coverage: 733:875/896 of query aligns to 150:288/333 of O05581
Sites not aligning to the query:
4avaA Crystal structure of protein lysine acetyltransferase rv0998 from mycobacterium tuberculosis (see paper)
30% identity, 16% coverage: 733:875/896 of query aligns to 149:282/327 of 4avaA
4ollA Camp-binding acyltransferase from mycobacterium smegmatis (see paper)
30% identity, 16% coverage: 736:875/896 of query aligns to 148:273/316 of 4ollA
1y81A Conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus
26% identity, 9% coverage: 15:99/896 of query aligns to 2:84/116 of 1y81A
Sites not aligning to the query:
2e6uX Crystal structure of hypothetical protein ph1109 from pyrococcus horikoshii (see paper)
28% identity, 9% coverage: 15:99/896 of query aligns to 23:105/142 of 2e6uX
Sites not aligning to the query:
2d5aA Hypothetical protein from pyrococcus horikoshii ot3 (see paper)
28% identity, 9% coverage: 15:99/896 of query aligns to 23:105/142 of 2d5aA
Sites not aligning to the query:
1scuA The crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution (see paper)
28% identity, 22% coverage: 94:292/896 of query aligns to 87:284/288 of 1scuA
Sites not aligning to the query:
P0AGE9 Succinate--CoA ligase [ADP-forming] subunit alpha; Succinyl-CoA synthetase subunit alpha; SCS-alpha; EC 6.2.1.5 from Escherichia coli (strain K12) (see 6 papers)
28% identity, 22% coverage: 94:292/896 of query aligns to 88:285/289 of P0AGE9
Sites not aligning to the query:
>Dsui_2189 FitnessBrowser__PS:Dsui_2189
MHEEEHYLTSLFEPKSVAVIGASDRENSVGNIIYRNIVAAGYKGRLYPINPKHDTVQGVQ
AYKSIEEIGARVDLAVIATQARTVPAIIEQCGRSGVKNVVVITAGFAEAGHSGAALERKM
VEIARSYGVRILGPNCLGLIRPVQGLNATFANISANPGNLALVSQSGALCTAILDWAKVN
DVGFSSVISTGGSADIDFGEILDYLVYDNRTHYILMYVEGIRNARRFMSAMRSAARIKPI
LLLKAGRYESGSVAAQVHSGMALGSDAVFDAALKRAGVVRVRNIGQLFYAAKGLASKFRP
DGNKLLIITNGGGPGAMAADRAAELGIPLADLSQSTIASLNAVLPPTWSHANPIDIVGDA
TPERYRDAILAGTQDPEVDGILVMLTPQAMTQPEEVAKAVITASETCTKPIVGCWMGEQQ
TYPARKMLTEAGIPAFRMPETAVDLFSHLSTYYRNQKLLLQTPEPISRQAKTATEGAKML
IEAVLSERRKVLSEMESKSVLRAFKIPVAQTMVARTPTEALLLAEQIGFPVVMKVDSPDL
PRKSEVGGVRLNIISAAAVRNAYHDILDTVGRNAPSARINGVSIEPFVARPNGRELKVGV
IRDRVFGPVITFGVGGAECEVFNDTAVALPPMNSYLVEDLIRSTRAAKILGDYRNMPAAN
MEALEDVLLRISQMVCELPWLQELDLNPLIVDENGAIAADARIVIDFAPSSGDRYSHMAI
HPYPAHLVEDWVLPDGQVVVIRPIRPEDAEMEKEFVAHLSDESKYFRFMDTLRELTQSML
VRFTQIDYDREMAFVAVTEEDGKEVQVGVSRFVSNPDGETVEFALAVADGWQKRGVGRKL
MSAIIECARAKGYRAVVGDVLALNSKMFKLMTSLGFTIHPHPEDPAVKRVIKPLTD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory