Comparing Dsui_2368 FitnessBrowser__PS:Dsui_2368 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
46% identity, 65% coverage: 5:168/251 of query aligns to 81:244/250 of 4hzdA
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
47% identity, 67% coverage: 1:168/251 of query aligns to 73:240/258 of 8i04A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
47% identity, 67% coverage: 1:168/251 of query aligns to 76:243/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
47% identity, 67% coverage: 1:168/251 of query aligns to 77:244/244 of 8i06A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
46% identity, 67% coverage: 1:168/251 of query aligns to 77:244/262 of 1t3dA
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
44% identity, 70% coverage: 1:175/251 of query aligns to 80:254/272 of 3gvdI
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
47% identity, 60% coverage: 5:154/251 of query aligns to 103:252/280 of 7bw9A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
44% identity, 71% coverage: 8:185/251 of query aligns to 80:250/257 of 1ssqD
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
45% identity, 67% coverage: 8:175/251 of query aligns to 80:247/258 of 4h7oA
Sites not aligning to the query:
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
48% identity, 64% coverage: 8:168/251 of query aligns to 83:243/243 of 4n69A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
43% identity, 63% coverage: 8:166/251 of query aligns to 85:243/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
43% identity, 63% coverage: 8:166/251 of query aligns to 83:241/243 of 7ra4A
1sstA Serine acetyltransferase- complex with coa (see paper)
45% identity, 64% coverage: 8:168/251 of query aligns to 80:233/233 of 1sstA
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
47% identity, 64% coverage: 8:168/251 of query aligns to 79:233/233 of 4n6bA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
42% identity, 62% coverage: 5:159/251 of query aligns to 105:267/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
42% identity, 62% coverage: 5:159/251 of query aligns to 103:265/267 of 3q1xA
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 49% coverage: 56:178/251 of query aligns to 23:167/191 of G3XD01
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
32% identity, 39% coverage: 71:167/251 of query aligns to 28:140/294 of 4mzuF
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
31% identity, 46% coverage: 68:182/251 of query aligns to 25:157/290 of 4mzuB
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 43% coverage: 62:169/251 of query aligns to 70:183/203 of P07464
Sites not aligning to the query:
>Dsui_2368 FitnessBrowser__PS:Dsui_2368
MFARLREDIHSVFDRDPAARSVLEVLTCYPGIHAITLHRLAHWLWGHRLRWLARFVAHIA
RFLTGIEIHPGATIGRRFFIDHGMGVVIGETAVIGDDVTLYHGVTLGGTSWNKGKRHPTL
ENGVVIGAGAKVLGPITMGAGAKVGSNAVVVRDVPGGATAVGNPARIIQGEQEQKREEKA
VKMGFSAYAVAQQNQDDPLAKAIHGLLDHAVETDRRIETLLHKLEQAGVRVEDELAVADR
FDPKYLSKIVD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory