Comparing Dsui_2532 FitnessBrowser__PS:Dsui_2532 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
67% identity, 91% coverage: 27:338/341 of query aligns to 1:312/314 of 4p8bA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
31% identity, 89% coverage: 28:331/341 of query aligns to 1:294/301 of 4nq8B
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
31% identity, 85% coverage: 42:331/341 of query aligns to 18:300/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
31% identity, 85% coverage: 42:331/341 of query aligns to 18:300/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
31% identity, 85% coverage: 42:331/341 of query aligns to 18:300/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
31% identity, 85% coverage: 42:331/341 of query aligns to 18:300/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
31% identity, 85% coverage: 42:331/341 of query aligns to 19:301/310 of 7bbrA
Sites not aligning to the query:
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
33% identity, 85% coverage: 44:332/341 of query aligns to 17:296/301 of 4pdhA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
32% identity, 86% coverage: 44:336/341 of query aligns to 20:303/304 of 4pakA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
32% identity, 86% coverage: 44:336/341 of query aligns to 19:302/303 of 4p9kA
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
30% identity, 84% coverage: 39:323/341 of query aligns to 11:286/303 of 4p3lA
Sites not aligning to the query:
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
28% identity, 87% coverage: 43:338/341 of query aligns to 16:302/303 of 4pddA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
30% identity, 88% coverage: 32:332/341 of query aligns to 7:299/304 of 4x8rA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
30% identity, 99% coverage: 1:337/341 of query aligns to 4:321/329 of P44542
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
32% identity, 85% coverage: 45:335/341 of query aligns to 18:302/305 of 4mnpA
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
30% identity, 92% coverage: 25:337/341 of query aligns to 1:298/309 of 2v4cA
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
30% identity, 92% coverage: 25:337/341 of query aligns to 1:298/308 of 2wx9A
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
31% identity, 86% coverage: 45:337/341 of query aligns to 18:297/305 of 2cexB
Sites not aligning to the query:
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
31% identity, 86% coverage: 45:337/341 of query aligns to 18:297/304 of 2cexA
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
30% identity, 92% coverage: 25:337/341 of query aligns to 1:298/310 of 3b50A
>Dsui_2532 FitnessBrowser__PS:Dsui_2532
MKKLVAAASLALALLPLGHSVAHAADYKSEYRLSTVLGPAFPWGKAGERWAELVKQKTEG
RINIKLYPGTSLVGGDQTREFSAIRQGVIDLAIGSSINWSPQVKQLNLFSLPFLTPDEKS
LDALIKGPVGKDLFAVLEKQGVVPLAYGENGFRELSNSRHPIRTPADLKGMKIRVVGSPI
FIDAFSALGANPTQMSWADAQPALATKAVDGQENPLSVFNAAKLHTLGQQHLTLWGYMTD
PLIFVVNRNVWNNWSEADRKAVREAAEQAAAENLVAARKGVSPGDDALLKDIEKNGVTIT
RLTAEQRKAFKDLTRPVYDKWAETVGKDLVKKAEAAIAAGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory