Comparing Dsui_2650 FitnessBrowser__PS:Dsui_2650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
54% identity, 91% coverage: 27:325/330 of query aligns to 2:300/344 of 4yicA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
53% identity, 89% coverage: 26:318/330 of query aligns to 1:293/330 of 7ug8B
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
52% identity, 92% coverage: 28:329/330 of query aligns to 2:302/337 of 2hzlB
Sites not aligning to the query:
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
52% identity, 91% coverage: 30:329/330 of query aligns to 32:330/365 of Q3J1R2
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
40% identity, 91% coverage: 31:329/330 of query aligns to 4:306/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
38% identity, 91% coverage: 31:329/330 of query aligns to 5:307/329 of 4petA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 95% coverage: 1:315/330 of query aligns to 4:324/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
29% identity, 86% coverage: 31:315/330 of query aligns to 4:293/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
29% identity, 86% coverage: 31:315/330 of query aligns to 4:293/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
30% identity, 70% coverage: 31:260/330 of query aligns to 2:230/315 of 4pe3A
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
24% identity, 90% coverage: 28:323/330 of query aligns to 1:291/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
24% identity, 89% coverage: 29:323/330 of query aligns to 1:290/315 of 4uabA
7e9yA Crystal structure of elacco1 (see paper)
30% identity, 56% coverage: 31:214/330 of query aligns to 4:184/563 of 7e9yA
Sites not aligning to the query:
2pfyA Crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
26% identity, 83% coverage: 32:305/330 of query aligns to 4:271/301 of 2pfyA
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
28% identity, 52% coverage: 158:329/330 of query aligns to 128:295/306 of 4xfeA
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
26% identity, 81% coverage: 50:317/330 of query aligns to 22:294/314 of 4p8bA
Sites not aligning to the query:
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
22% identity, 86% coverage: 46:329/330 of query aligns to 17:300/305 of 2cexB
Sites not aligning to the query:
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
22% identity, 86% coverage: 46:329/330 of query aligns to 17:300/304 of 2cexA
Sites not aligning to the query:
2pfzA Crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
23% identity, 73% coverage: 30:271/330 of query aligns to 1:236/301 of 2pfzA
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
22% identity, 86% coverage: 46:329/330 of query aligns to 18:301/308 of 2wx9A
Sites not aligning to the query:
>Dsui_2650 FitnessBrowser__PS:Dsui_2650
MQRRDFLLGAGASAALGAATARAADGQPVVRWRLASSYPKSLDTLYGASEVLANRVAALT
EGRFQIRPFAAGEIVPGLQALDAVQQDTVECGHTLGSFYVGKNRAFAFDSVLPFGLTTRQ
QTAWMHFGNGLTLLRELYRDYGVINFPGGNTGAQMGGWFRKELQGLADLKGLKMRIPGLG
GEIMARLGAVPQTIPGADVYPALEKGAIDAAEWSGPYDDEKLGFFKVARYYYHPGWWEPS
AQLSFLVNAREWEKLPKAYQQAFEVAAAEAHLLTTAEYDAKNPPALTRLLAQGVKLRRFP
DDVMKAAYRAAFAFYERVGRESSEILEKIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory