Comparing Dsui_2711 FitnessBrowser__PS:Dsui_2711 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
65% identity, 98% coverage: 8:382/383 of query aligns to 1:375/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
65% identity, 98% coverage: 8:382/383 of query aligns to 1:375/375 of 4pqaA
7lgpB Dape enzyme from shigella flexneri
57% identity, 99% coverage: 5:382/383 of query aligns to 3:376/377 of 7lgpB
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
59% identity, 94% coverage: 24:382/383 of query aligns to 17:375/377 of 7t1qA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
51% identity, 98% coverage: 6:382/383 of query aligns to 3:379/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
52% identity, 98% coverage: 9:382/383 of query aligns to 2:375/377 of P44514
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
62% identity, 47% coverage: 8:187/383 of query aligns to 1:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
54% identity, 48% coverage: 6:187/383 of query aligns to 1:182/258 of 4h2kA
Sites not aligning to the query:
7rsfA Acetylornithine deacetylase from escherichia coli
28% identity, 86% coverage: 35:363/383 of query aligns to 35:359/380 of 7rsfA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 97% coverage: 11:381/383 of query aligns to 11:398/408 of Q03154
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 97% coverage: 11:381/383 of query aligns to 11:397/407 of P37111
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
31% identity, 38% coverage: 69:212/383 of query aligns to 99:232/426 of 3pfoA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
26% identity, 93% coverage: 6:363/383 of query aligns to 4:363/383 of 7uoiA
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
32% identity, 33% coverage: 69:196/383 of query aligns to 127:254/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
32% identity, 33% coverage: 69:196/383 of query aligns to 96:221/471 of 3dljA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
28% identity, 48% coverage: 5:187/383 of query aligns to 11:212/475 of Q96KP4
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
31% identity, 39% coverage: 57:205/383 of query aligns to 106:262/503 of Q8C165
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
29% identity, 34% coverage: 19:147/383 of query aligns to 30:164/458 of 2pokA
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
22% identity, 86% coverage: 3:332/383 of query aligns to 9:417/475 of Q9D1A2
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
22% identity, 86% coverage: 3:332/383 of query aligns to 13:421/478 of 2zogA
Sites not aligning to the query:
>Dsui_2711 FitnessBrowser__PS:Dsui_2711
MSQPISCTSDPTLDLAAQLISRRSVTPEDGGCMDLISARLKPLGFTLEAINQGNTVNLWA
RRGSAAPLVCLAGHTDVVPTGPVEQWASDPFTPTLRDGMLYGRGAADMKGSLAAFVTAVE
TFVARHPQHQGSIAFLLTSDEEGDATDGTVAVVEALQARGEGIDCCIVGEPTCVNRLGDM
VKNGRRGSLSGRLTVKGIQGHIAYPHLAKNPIHLAAPAIAELAATEWDQGNEYFPPTTWQ
VSNIRGGTGATNVIPGTVDILFNFRFSTASTPEGLKSRLEAVLAKHGIDYDLAWTLGAKP
FLTGRGPLVDAAMAAIREELNIETELSTTGGTSDGRFIAEICPQVIELGPVNATIHKIDE
CVEAAALPRLSATYCRILEKLLT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory