SitesBLAST
Comparing Dsui_2880 FitnessBrowser__PS:Dsui_2880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
38% identity, 95% coverage: 7:430/447 of query aligns to 5:428/448 of 3du4A
- active site: F17 (≠ C19), Y146 (= Y152), E217 (= E224), D251 (= D258), A254 (= A261), K280 (= K292), A417 (≠ Y419)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A88), Y146 (= Y152), G315 (≠ S326), S317 (= S328), R410 (= R412)
- binding pyridoxal-5'-phosphate: S112 (≠ D118), G113 (= G119), A114 (= A120), Y146 (= Y152), H147 (= H153), E217 (= E224), D251 (= D258), V253 (≠ I260), A254 (= A261), K280 (= K292), H316 (= H327), S317 (= S328)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
38% identity, 95% coverage: 7:430/447 of query aligns to 5:428/448 of P53555
- GA 113:114 (= GA 119:120) binding
- Y146 (= Y152) binding
- K280 (= K292) modified: N6-(pyridoxal phosphate)lysine
- G315 (≠ S326) binding
- HS 316:317 (= HS 327:328) binding
- R410 (= R412) binding
6wnnA Bacillus subtilis bioa in complex with amino donor l-lys
36% identity, 95% coverage: 7:430/447 of query aligns to 2:400/420 of 6wnnA
- active site: F14 (≠ C19), Y143 (= Y152), D223 (= D258), K252 (= K292)
- binding (2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid: F14 (≠ C19), W51 (= W60), S109 (≠ D118), G110 (= G119), A111 (= A120), Y143 (= Y152), H144 (= H153), D223 (= D258), V225 (≠ I260), K252 (= K292), R382 (= R412)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: H288 (= H327), S289 (= S328)
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
34% identity, 97% coverage: 4:435/447 of query aligns to 1:426/438 of 6zhkA
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
37% identity, 94% coverage: 15:434/447 of query aligns to 13:413/429 of P12995
- Y17 (≠ C19) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W59) binding
- GS 112:113 (≠ GA 119:120) binding
- Y144 (= Y152) mutation to F: Severely reduces the aminotransferase activity.
- D147 (≠ E155) mutation to N: Loss of aminotransferase activity.
- D245 (= D258) binding
- R253 (= R266) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K292) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (≠ S326) binding
- PT 308:309 (≠ HS 327:328) binding
- R391 (= R412) binding ; mutation to A: Reduces aminotransferase activity.
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
37% identity, 94% coverage: 15:434/447 of query aligns to 13:413/429 of 6ed7A
- active site: Y17 (≠ C19), Y144 (= Y152), D245 (= D258), K274 (= K292)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ C19), W52 (= W59), W52 (= W59), Y144 (= Y152), D147 (≠ E155), A217 (= A230), K274 (= K292), R391 (= R412), F393 (≠ I414), F393 (≠ I414)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), D245 (= D258), I247 (= I260), K274 (= K292)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
37% identity, 94% coverage: 15:434/447 of query aligns to 13:413/429 of 1dtyA
- active site: Y17 (≠ C19), Y144 (= Y152), E211 (= E224), D245 (= D258), A248 (= A261), K274 (= K292), Y398 (= Y419)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), D245 (= D258), I247 (= I260), K274 (= K292)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
32% identity, 97% coverage: 15:446/447 of query aligns to 14:417/420 of 6erkA
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
36% identity, 94% coverage: 15:434/447 of query aligns to 13:401/416 of 1qj3A
- active site: Y17 (≠ C19), Y144 (= Y152), E201 (= E224), D235 (= D258), A238 (= A261), K264 (= K292), Y386 (= Y419)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ C19), W52 (= W59), Y144 (= Y152), K264 (= K292), R379 (= R412), F381 (≠ I414)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), G146 (= G154), D235 (= D258), I237 (= I260), A238 (= A261), K264 (= K292)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
36% identity, 94% coverage: 15:434/447 of query aligns to 13:412/427 of 1mlzA
- active site: Y17 (≠ C19), Y144 (= Y152), E210 (= E224), D244 (= D258), A247 (= A261), K273 (= K292), Y397 (= Y419)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), D244 (= D258), I246 (= I260), K273 (= K292), P307 (≠ H327), T308 (≠ S328)
- binding trans-amiclenomycin: W52 (= W59), W53 (= W60), Y144 (= Y152), K273 (= K292), R390 (= R412), F392 (≠ I414)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
36% identity, 94% coverage: 15:434/447 of query aligns to 13:412/427 of 1mlyA
- active site: Y17 (≠ C19), Y144 (= Y152), E210 (= E224), D244 (= D258), A247 (= A261), K273 (= K292), Y397 (= Y419)
- binding cis-amiclenomycin: W52 (= W59), W53 (= W60), K273 (= K292), R390 (= R412), F392 (≠ I414)
- binding pyridoxal-5'-phosphate: G112 (= G119), S113 (≠ A120), Y144 (= Y152), H145 (= H153), D244 (= D258), I246 (= I260), K273 (= K292), P307 (≠ H327), T308 (≠ S328)
3tfuA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, post-reaction complex with a 3,6- dihydropyrid-2-one heterocycle inhibitor (see paper)
35% identity, 90% coverage: 41:443/447 of query aligns to 37:412/417 of 3tfuA
- active site: Y151 (= Y152), E204 (= E224), D238 (= D258), A241 (= A261), K267 (= K292), Y391 (= Y419)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-2-oxo-1,2-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: W58 (= W59), G118 (= G119), S119 (≠ A120), Y151 (= Y152), H152 (= H153), D238 (= D258), I240 (= I260), K267 (= K292), P301 (≠ H327), T302 (≠ S328)
Sites not aligning to the query:
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
35% identity, 96% coverage: 13:443/447 of query aligns to 12:420/427 of 4cxqA
- active site: Y18 (≠ C19), Y149 (= Y152), E212 (= E224), D246 (= D258), A249 (= A261), K275 (= K292), Y399 (= Y419)
- binding 7-keto-8-aminopelargonic acid: W56 (= W59), Y149 (= Y152), G308 (≠ S326), T310 (≠ S328), R392 (= R412)
- binding pyridoxal-5'-phosphate: G116 (= G119), S117 (≠ A120), Y149 (= Y152), H150 (= H153), G151 (= G154), E212 (= E224), D246 (= D258), I248 (= I260), K275 (= K292), P309 (≠ H327), T310 (≠ S328)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
35% identity, 96% coverage: 13:443/447 of query aligns to 12:418/425 of 4w1vA
- active site: Y18 (≠ C19), Y147 (= Y152), E210 (= E224), D244 (= D258), A247 (= A261), K273 (= K292), Y397 (= Y419)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P18), Y18 (≠ C19), W54 (= W59), M81 (≠ I86), G83 (≠ A88), Y147 (= Y152), G306 (≠ S326), P307 (≠ H327), T308 (≠ S328), F392 (≠ I414)
- binding pyridoxal-5'-phosphate: G114 (= G119), S115 (≠ A120), Y147 (= Y152), H148 (= H153), E210 (= E224), D244 (= D258), I246 (= I260), K273 (= K292)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
35% identity, 96% coverage: 13:443/447 of query aligns to 12:418/425 of 4cxrA
- active site: Y18 (≠ C19), Y147 (= Y152), E210 (= E224), D244 (= D258), A247 (= A261), K273 (= K292), Y397 (= Y419)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ C19), W54 (= W59), W55 (= W60), A216 (= A230)
- binding pyridoxal-5'-phosphate: G114 (= G119), S115 (≠ A120), Y147 (= Y152), H148 (= H153), E210 (= E224), D244 (= D258), I246 (= I260), K273 (= K292), P307 (≠ H327), T308 (≠ S328)
6ge8B Crystal structure of mycobacterium tuberculosis bioa
35% identity, 90% coverage: 41:443/447 of query aligns to 37:414/420 of 6ge8B
- binding [(2~{S})-3-(1~{H}-indol-3-yl)-1-[(2~{E})-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene]hydrazinyl]-1-oxidanylidene-propan-2-yl]azanium: W58 (= W59), G118 (= G119), S119 (≠ A120), Y151 (= Y152), H152 (= H153), A212 (= A230), D240 (= D258), I242 (= I260), K269 (= K292), P303 (≠ H327), T304 (≠ S328)
- binding magnesium ion: H152 (= H153), G153 (= G154), A158 (= A159), C162 (≠ T163)
6ge8A Crystal structure of mycobacterium tuberculosis bioa
35% identity, 90% coverage: 41:443/447 of query aligns to 37:416/422 of 6ge8A
- binding [(2~{S})-3-(1~{H}-indol-3-yl)-1-[(2~{E})-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene]hydrazinyl]-1-oxidanylidene-propan-2-yl]azanium: W58 (= W59), G118 (= G119), S119 (≠ A120), Y151 (= Y152), H152 (= H153), E208 (= E224), D242 (= D258), I244 (= I260), K271 (= K292), P305 (≠ H327), T306 (≠ S328)
Sites not aligning to the query:
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 90% coverage: 41:443/447 of query aligns to 43:428/437 of P9WQ81
- W64 (= W59) binding
- Y157 (= Y152) binding
- K283 (= K292) modified: N6-(pyridoxal phosphate)lysine
- G316 (≠ S326) binding
Sites not aligning to the query:
- 25 Y→A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
35% identity, 90% coverage: 41:443/447 of query aligns to 36:421/429 of 5kgtA
- active site: Y150 (= Y152), E213 (= E224), D247 (= D258), A250 (= A261), K276 (= K292), Y400 (= Y419)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (≠ I86), G86 (≠ A88), G309 (≠ S326), T311 (≠ S328)
- binding pyridoxal-5'-phosphate: S116 (≠ D118), G117 (= G119), S118 (≠ A120), Y150 (= Y152), H151 (= H153), G152 (= G154), E213 (= E224), D247 (= D258), I249 (= I260), K276 (= K292)
Sites not aligning to the query:
5kgsA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one (see paper)
35% identity, 90% coverage: 41:443/447 of query aligns to 36:421/429 of 5kgsA
- active site: Y150 (= Y152), E213 (= E224), D247 (= D258), A250 (= A261), K276 (= K292), Y400 (= Y419)
- binding 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2,3-dihydroinden-1-one: W57 (= W59), M84 (≠ I86), G86 (≠ A88), Y150 (= Y152), D162 (= D164), G165 (vs. gap), G166 (vs. gap), P310 (≠ H327), T311 (≠ S328), F395 (≠ I414)
- binding pyridoxal-5'-phosphate: G117 (= G119), S118 (≠ A120), Y150 (= Y152), H151 (= H153), G152 (= G154), E213 (= E224), D247 (= D258), I249 (= I260), K276 (= K292)
Sites not aligning to the query:
Query Sequence
>Dsui_2880 FitnessBrowser__PS:Dsui_2880
MSANRRLLDRSLAAVWHPCTQMQHHLAADGLPLIPVQSGAGVWLTDFDGRRYLDGVSSWW
VNLFGHRNPRINAALRDQLETLEHVILAGFTHEPVVQLSERLSALTGGALGHAFYASDGA
SATEIALKMSHHYWRNTGQPEKTDFLCLEGSYHGETVGALAVTDVALFKDAYAPLIRPAA
VLPSPDARLARDGETAADVARRAAAALEAHLQAHHGHIAALIVEPLIQCATGMAMHDPLY
LSLARQACDRYGVHLICDEIAVGFGRSGTFFAHEQAAVDGKTVRPDFLCLSKGITGGYLP
LSVVLTTDTVYEAFLDDAVTRGFLHSHSYTGNALACRAALATLDIFEQDDVIAANRQLSE
RLHQLLEPLRQHPRVRHYRRRGMILAFDVEGADASFSRRFYKAGLERELMLRPIGNTVYL
MPPYVLSEDEARHLCQGTLATLEATLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory