Comparing Dsui_2958 FitnessBrowser__PS:Dsui_2958 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5x40A Structure of a cbio dimer bound with amppcp (see paper)
47% identity, 97% coverage: 5:274/279 of query aligns to 4:274/280 of 5x40A
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
36% identity, 93% coverage: 6:264/279 of query aligns to 3:268/280 of Q5M244
5d3mA Folate ecf transporter: amppnp bound state (see paper)
35% identity, 97% coverage: 5:276/279 of query aligns to 5:277/280 of 5d3mA
8bmpB Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
41% identity, 70% coverage: 6:201/279 of query aligns to 2:204/281 of 8bmpB
5d3mB Folate ecf transporter: amppnp bound state (see paper)
41% identity, 70% coverage: 6:201/279 of query aligns to 2:204/281 of 5d3mB
8bmsB Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
40% identity, 70% coverage: 6:201/279 of query aligns to 2:204/281 of 8bmsB
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
33% identity, 91% coverage: 5:258/279 of query aligns to 1:254/276 of Q5M243
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
34% identity, 95% coverage: 12:276/279 of query aligns to 10:274/278 of 8bmpA
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
34% identity, 95% coverage: 12:276/279 of query aligns to 9:274/278 of 8bmsA
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
40% identity, 71% coverage: 6:203/279 of query aligns to 5:195/249 of 4hluC
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
39% identity, 71% coverage: 6:203/279 of query aligns to 4:191/247 of 4zirB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 70% coverage: 22:217/279 of query aligns to 17:212/240 of 4ymuJ
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
34% identity, 78% coverage: 5:221/279 of query aligns to 1:217/222 of 8i6rB
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
33% identity, 74% coverage: 12:218/279 of query aligns to 13:215/265 of 4hluA
Sites not aligning to the query:
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
34% identity, 74% coverage: 12:218/279 of query aligns to 13:213/263 of 4zirA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
38% identity, 71% coverage: 22:220/279 of query aligns to 18:215/241 of 4u00A
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
33% identity, 76% coverage: 5:217/279 of query aligns to 1:213/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
33% identity, 76% coverage: 5:217/279 of query aligns to 1:213/219 of 8w6iD
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 73% coverage: 22:226/279 of query aligns to 19:229/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 73% coverage: 22:226/279 of query aligns to 19:229/242 of 3c41J
Sites not aligning to the query:
>Dsui_2958 FitnessBrowser__PS:Dsui_2958
MSVALLQLEEVHYRYPDGSAGLAGCSLSVSRGSRNALIGANGSGKTTLFQHCNGLLRPAA
GRVHYAGAPVDYGRAGLRALRSKVGLVFQNPDRQLFSASVREDVSFGPLNLGLDEATVAA
RVEAALQAVGMDDLAHKPVQNLSFGQKKRVCIAGVLAMEPELLVLDEPMAGLDQAMQEEL
LAVLDGLHRRGMTILLATHDIHFAYRWADRIHLMAAGRCCASFDAPALAGHEAELAAIGL
RLPSVIGLERQLRQRGLLRGDTPIHSCSALLAQLQQEDC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory