SitesBLAST
Comparing Dsui_3030 FitnessBrowser__PS:Dsui_3030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xfaA Crystal structure of NAD+-reducing [nife]-hydrogenase in the h2- reduced state (see paper)
47% identity, 92% coverage: 44:599/602 of query aligns to 22:576/581 of 5xfaA
5xf9A Crystal structure of NAD+-reducing [nife]-hydrogenase in the air- oxidized state (see paper)
45% identity, 95% coverage: 17:585/602 of query aligns to 2:566/576 of 5xf9A
- binding flavin mononucleotide: G197 (= G214), G199 (= G216), K208 (= K225), N225 (= N242), D227 (= D244), Y309 (= Y331), G312 (= G334), E313 (= E335), E314 (= E336), N348 (= N370), N349 (= N371), F522 (≠ L541)
- binding iron/sulfur cluster: P328 (= P350), S473 (= S492), C474 (= C493), G475 (= G494), F476 (= F495), C477 (= C496), C480 (= C499), N519 (≠ H538), C520 (= C539), F522 (≠ L541)
Sites not aligning to the query:
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
38% identity, 75% coverage: 116:565/602 of query aligns to 41:529/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C48 (= C123), F49 (≠ T124), L51 (≠ M126), C52 (= C127)
- binding flavin mononucleotide: G166 (= G214), G168 (= G216), N196 (= N242), D198 (= D244), F284 (≠ Y331), G287 (= G334), E288 (= E335), E289 (= E336), N324 (= N371)
- binding iron/sulfur cluster: C457 (= C493), G458 (= G494), K459 (≠ F495), C460 (= C496), C463 (= C499), C503 (= C539), G506 (= G542)
- binding zinc ion: C440 (≠ D476), H527 (≠ R563)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 533
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
43% identity, 62% coverage: 194:565/602 of query aligns to 34:415/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D476), C364 (≠ A514), H413 (≠ R563)
- binding flavin mononucleotide: G54 (= G214), G56 (= G216), K65 (= K225), N82 (= N242), D84 (= D244), E85 (= E245), G173 (= G334), E175 (= E336), N210 (= N371), G390 (= G540), L391 (= L541)
- binding nicotinamide-adenine-dinucleotide: G56 (= G216), G57 (= G217), A58 (= A218), F60 (= F220), K65 (= K225), F68 (≠ A228), E85 (= E245), E175 (= E336), R192 (= R353), F195 (= F356), I312 (≠ F468), M313 (= M469), S315 (vs. gap)
- binding iron/sulfur cluster: S342 (= S492), C343 (= C493), G344 (= G494), C346 (= C496), C349 (= C499), S387 (= S537), C389 (= C539), L391 (= L541), G392 (= G542)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
43% identity, 62% coverage: 194:565/602 of query aligns to 34:415/425 of 7t2rB
Sites not aligning to the query:
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
42% identity, 60% coverage: 200:560/602 of query aligns to 49:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G214), K74 (= K225), N91 (= N242), D93 (= D244), Y179 (= Y331), G182 (= G334), E183 (= E335), N218 (= N370), N219 (= N371), L401 (= L541)
- binding iron/sulfur cluster: I180 (≠ V332), P198 (= P350), S351 (= S492), C352 (= C493), G353 (= G494), K354 (≠ F495), C355 (= C496), C358 (= C499), F398 (≠ H538), C399 (= C539), L401 (= L541)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
42% identity, 60% coverage: 200:560/602 of query aligns to 49:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G214), G65 (= G216), N91 (= N242), D93 (= D244), G182 (= G334), E183 (= E335), E184 (= E336), N218 (= N370), N219 (= N371), T222 (= T374), P400 (≠ G540)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G216), G66 (= G217), F69 (= F220), K74 (= K225), F77 (≠ A228), E96 (= E247), Y179 (= Y331), E184 (= E336), K201 (≠ R353), F204 (= F356), T324 (vs. gap)
- binding iron/sulfur cluster: S351 (= S492), C352 (= C493), K354 (≠ F495), C355 (= C496), C358 (= C499), F398 (≠ H538), C399 (= C539), L401 (= L541), A402 (≠ G542)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
42% identity, 60% coverage: 200:560/602 of query aligns to 50:421/438 of Q56222
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
37% identity, 74% coverage: 116:560/602 of query aligns to 60:541/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C67 (= C123), C68 (≠ T124), G69 (= G125), R70 (≠ M126), C71 (= C127)
- binding flavin mononucleotide: G185 (= G214), R186 (= R215), G187 (= G216), N213 (= N242), D215 (= D244), E216 (= E245), G217 (= G246), F301 (≠ Y331), G304 (= G334), E305 (= E335), E306 (= E336), N340 (= N370), N341 (= N371), G521 (= G540), L522 (= L541)
- binding iron/sulfur cluster: P320 (= P350), S473 (= S492), C474 (= C493), G475 (= G494), K476 (≠ F495), C477 (= C496), C480 (= C499), L519 (≠ H538), C520 (= C539), L522 (= L541), G523 (= G542)
- binding zinc ion: C457 (≠ D476)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
41% identity, 62% coverage: 191:562/602 of query aligns to 41:415/419 of 6saqB
- binding flavin mononucleotide: G64 (= G214), G66 (= G216), K75 (= K225), N91 (= N242), D93 (= D244), E94 (= E245), Y179 (= Y331), G182 (= G334), E183 (= E335), N218 (= N370), N219 (= N371), T222 (= T374)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G216), G67 (= G217), A68 (= A218), F70 (= F220), K75 (= K225), E94 (= E245), E96 (= E247), T99 (= T250), E184 (= E336), Y204 (≠ F356), T318 (≠ A465)
- binding iron/sulfur cluster: P198 (= P350), T345 (≠ S492), C346 (= C493), G347 (= G494), Q348 (≠ F495), C349 (= C496), C352 (= C499), I391 (≠ H538), C392 (= C539), G395 (= G542)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
41% identity, 62% coverage: 191:562/602 of query aligns to 41:415/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G214), G66 (= G216), K75 (= K225), N91 (= N242), D93 (= D244), E94 (= E245), G182 (= G334), E183 (= E335), E184 (= E336), V217 (= V369), N218 (= N370), N219 (= N371), T222 (= T374), G393 (= G540)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G216), G67 (= G217), A68 (= A218), F70 (= F220), K75 (= K225), E94 (= E245), E96 (= E247), Y179 (= Y331), E184 (= E336), Y204 (≠ F356)
- binding iron/sulfur cluster: P198 (= P350), T345 (≠ S492), C346 (= C493), G347 (= G494), Q348 (≠ F495), C349 (= C496), C352 (= C499), I391 (≠ H538), C392 (= C539), L394 (= L541), G395 (= G542)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
41% identity, 62% coverage: 191:562/602 of query aligns to 42:416/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G214), G67 (= G216), K76 (= K225), N92 (= N242), E95 (= E245), Y180 (= Y331), G183 (= G334), E184 (= E335), V218 (= V369), N219 (= N370), N220 (= N371), T223 (= T374)
- binding iron/sulfur cluster: T346 (≠ S492), C347 (= C493), G348 (= G494), Q349 (≠ F495), C350 (= C496), C353 (= C499), S391 (= S537), I392 (≠ H538), C393 (= C539), G396 (= G542)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
41% identity, 62% coverage: 191:562/602 of query aligns to 40:414/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G214), G65 (= G216), K74 (= K225), N90 (= N242), D92 (= D244), E93 (= E245), G181 (= G334), E182 (= E335), E183 (= E336), V216 (= V369), N217 (= N370), N218 (= N371), T221 (= T374)
- binding nicotinamide-adenine-dinucleotide: G65 (= G216), G66 (= G217), A67 (= A218), F69 (= F220), K74 (= K225), E95 (= E247), Y178 (= Y331), E183 (= E336), K200 (≠ R353), Y203 (≠ F356)
- binding iron/sulfur cluster: I179 (≠ V332), P197 (= P350), T344 (≠ S492), C345 (= C493), G346 (= G494), Q347 (≠ F495), C348 (= C496), C351 (= C499), S389 (= S537), I390 (≠ H538), C391 (= C539), L393 (= L541), G394 (= G542)
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
43% identity, 61% coverage: 196:565/602 of query aligns to 19:400/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G214), G39 (= G216), N67 (= N242), G158 (= G334), E159 (= E335), E160 (= E336), G375 (= G540)
- binding nicotinamide-adenine-dinucleotide: G40 (= G217), F43 (= F220), K48 (= K225), R177 (= R353), F180 (= F356), M297 (≠ F468)
- binding iron/sulfur cluster: S327 (= S492), C328 (= C493), G329 (= G494), K330 (≠ F495), C331 (= C496), C334 (= C499), L373 (≠ H538), C374 (= C539)
- binding zinc ion: C311 (≠ D476), H398 (≠ R563)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
43% identity, 60% coverage: 204:565/602 of query aligns to 4:377/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G214), G16 (= G216), N44 (= N242), G135 (= G334), E137 (= E336), N171 (= N370), N172 (= N371), G352 (= G540)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G216), G17 (= G217), F20 (= F220), K25 (= K225), F28 (≠ A228), D49 (≠ E247), R154 (= R353), F157 (= F356), S250 (= S444)
- binding iron/sulfur cluster: P151 (= P350), C305 (= C493), G306 (= G494), K307 (≠ F495), C308 (= C496), C311 (= C499), C351 (= C539), G354 (= G542)
- binding zinc ion: C288 (≠ D476), H375 (≠ R563)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 381, 386
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
35% identity, 75% coverage: 116:565/602 of query aligns to 75:560/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C82 (= C123), F85 (≠ M126), C86 (= C127)
- binding flavin mononucleotide: G201 (= G216), N227 (= N242), E230 (= E245), N355 (= N371), G535 (= G540), L536 (= L541)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E336), R337 (= R353), R340 (≠ F356), T341 (≠ P357), N342 (≠ V358), S433 (= S444)
- binding iron/sulfur cluster: S487 (= S492), C488 (= C493), G489 (= G494), C491 (= C496), C494 (= C499), C534 (= C539), L536 (= L541), G537 (= G542)
- binding zinc ion: C471 (≠ D476), H558 (≠ R563)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 564
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
41% identity, 62% coverage: 191:565/602 of query aligns to 129:514/584 of 8oh5B
- binding flavin mononucleotide: R154 (= R215), K164 (= K225), N181 (= N242), F269 (≠ Y331), E273 (= E335), E274 (= E336), I307 (≠ V369), N308 (= N370), N309 (= N371), G489 (= G540), L490 (= L541)
- binding nicotinamide-adenine-dinucleotide: G155 (= G216), G156 (= G217), F159 (= F220), F163 (≠ V224), E273 (= E335), E274 (= E336), K291 (≠ R353), F294 (= F356), G413 (vs. gap)
- binding iron/sulfur cluster: P288 (= P350), C442 (= C493), G443 (= G494), C445 (= C496), C448 (= C499), C488 (= C539), L490 (= L541), G491 (= G542)
- binding zinc ion: C425 (≠ D476), H512 (≠ R563)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10, 41, 45
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 518, 523
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
40% identity, 62% coverage: 190:561/602 of query aligns to 37:420/442 of 7p61F
- binding flavin mononucleotide: G61 (= G214), G63 (= G216), K72 (= K225), N90 (= N242), D92 (= D244), G181 (= G334), E182 (= E335), N217 (= N370), N218 (= N371), A399 (≠ G540), H400 (≠ L541)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G216), G64 (= G217), A65 (= A218), F67 (= F220), K72 (= K225), L75 (≠ A228), E95 (= E247), Y178 (= Y331), E183 (= E336), F203 (= F356), R320 (vs. gap), T323 (vs. gap)
- binding iron/sulfur cluster: S350 (= S492), C351 (= C493), W353 (≠ F495), C354 (= C496), C357 (= C499), F397 (≠ H538), C398 (= C539), H400 (≠ L541)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
40% identity, 64% coverage: 191:574/602 of query aligns to 30:428/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G214), R54 (= R215), G55 (= G216), A57 (= A218), K64 (= K225), N90 (= N242), D92 (= D244), Y178 (= Y331), G181 (= G334), E182 (= E335), E183 (= E336), N217 (= N370), N218 (= N371), S221 (≠ T374), L398 (= L541)
- binding iron/sulfur cluster: P197 (= P350), S349 (= S492), C350 (= C493), G351 (= G494), K352 (≠ F495), C353 (= C496), C356 (= C499), S394 (= S537), F395 (≠ H538), C396 (= C539), L398 (= L541), G399 (= G542)
- binding zinc ion: C333 (≠ D476), E371 (≠ A514), H420 (≠ S566), C425 (≠ P571)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
40% identity, 61% coverage: 190:556/602 of query aligns to 130:506/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G214), G156 (= G216), K165 (= K225), N182 (= N242), E185 (= E245), G273 (= G334), E274 (= E335), E275 (= E336), N309 (= N370), N310 (= N371), S313 (≠ T374), A490 (≠ G540), M491 (≠ L541)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (= A218), F160 (= F220), K165 (= K225), T168 (≠ A228), E275 (= E336), L295 (≠ F356)
- binding iron/sulfur cluster: V271 (= V332), V289 (≠ P350), S442 (= S492), C443 (= C493), G444 (= G494), K445 (≠ F495), C446 (= C496), C449 (= C499), L488 (≠ H538), C489 (= C539), M491 (≠ L541), G492 (= G542)
Query Sequence
>Dsui_3030 FitnessBrowser__PS:Dsui_3030
MEPIANSLDAVLEAVLSKRRRDPTQLLQILREVQEQVGYIPPPALTAIAAALKLPRARVE
GVAGFYSFLHLQPVGKYRVLFSDNATDRLLGNLDLLGTMCQKLWVEQGKVSEDGLVSVDV
TSCTGMCDQGPALLVNGRPITRLTHQRVNEICELIRSRRPLSLWPQEYFRVEDNIRRKDD
LLNTVLEPGAALAAAMALGPEAWLGEVQKSSLRGRGGAGFTTGVKWEACRNAPGEERVIV
CNADEGEPGTFKDRVLLTSYPDHVFEGMTLAAYATGARQGFLYLRGEYRYLLEPLEAALQ
RRREAGLLGQGIRGQASFDFDIEIHLGAGAYVCGEETALIESLEGKRGTPRIRPPFPVIK
GYLGRPTVVNNVETLAKTVLIALEGAERFAAVGTAQSTGTKLLSISGDCAFPGIYEYPFG
VSIEQILEDCGATDVQAVQVGGASGTCLASYEFHRGIAYEDVPTAGSFMIFDTSRDLFEV
ARNFVHFFAHESCGFCTPCRVGTSLLRNFMDKLATGHGAKYDLADIEWINRLLKAASHCG
LGLAAANPVVETLIKFRPAYERRLQSLDFAPAFDLDQSLAEARRMTGRDDADAHLSSVEA
HR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory